KEGG   Burkholderia ambifaria AMMD: Bamb_4258Help
Entry
Bamb_4258         CDS       T00398                                 

Definition
lysozyme (EC:3.2.1.17)
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
bam  Burkholderia ambifaria AMMD
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:1182596..1183042
Genome map
AA seq 148 aa AA seqDB search
MANQPERTGAQGIALIKQFEGLRLARYLDAVGKPTIGYGHLILPNERFTRPLTPAEAEAL
LRRDLRGAELNLRKLLHVPVTQQQFDALMSFVFNLGAGRLRSSTLLRYLNAGARTRAADQ
FLVWNKAGGKPLAGLTKRRQAERALFLS
NT seq 447 nt NT seq  +upstreamnt  +downstreamnt
atggcgaaccagcctgaacgtaccggtgcgcagggcatcgcgctgatcaagcagttcgag
gggctgcgcctcgctcgctatctcgacgcggtcggcaagccgacgatcggctacgggcac
ctgatcctgccgaacgagcgcttcacgcgcccgctcacgcccgccgaagcggaggcgctg
ctgcgccgcgacctgcgcggcgccgagctgaacctgcgcaagctgctgcatgtgccggtc
acgcagcagcagttcgacgcgctgatgtcgttcgtcttcaatctcggcgcggggcggctg
cgctcgtcgacgctgctgcgctacctgaacgccggcgcgcgcacgcgtgcggccgaccag
ttcctcgtctggaacaaggccggcggcaagccgctcgcggggctcacgaagcgccgccag
gccgagcgcgcgctgtttctgtcatga

DBGET integrated database retrieval system