KEGG   Burkholderia ambifaria AMMD: Bamb_4502Help
Entry
Bamb_4502         CDS       T00398                                 

Definition
(GenBank) glutathione-independent formaldehyde dehydrogenase
  KO
K00148  glutathione-independent formaldehyde dehydrogenase [EC:1.2.1.46]
Organism
bam  Burkholderia ambifaria AMMD
Pathway
bam00625  Chloroalkane and chloroalkene degradation
bam00680  Methane metabolism
bam01100  Metabolic pathways
bam01120  Microbial metabolism in diverse environments
bam01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bam00001]
 Metabolism
  Energy metabolism
   00680 Methane metabolism
    Bamb_4502
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Bamb_4502
Enzymes [BR:bam01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.46  formaldehyde dehydrogenase
     Bamb_4502
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N AlaDh_PNT_C PALP FAD_binding_3 XdhC_C 2-Hacid_dh_C HI0933_like
Motif
Other DBs
NCBI-ProteinID: ABI90052
UniProt: Q0B721
Position
2:complement(1452146..1453342)
Genome map
AA seq 398 aa AA seqDB search
MSSNRGVVYLGPGKVEVQKIDYPKMVDPTGRAIGHGVILKVVSTNICGSDQHMVRGRTTA
PVGLVLGHEITGEVVEVGRDVETLKLGDLVSVPFNVACGRCAMCKDTHTGVCLNVNPSRA
GGAYGYVDMGGWIGGQAEYVLVPYADFNLLKFPDRDQAMAKIRDLTCLSDILPTGYHGAV
SAGVKPGSTVYIAGAGPVGMAAAASARLLGAAVTIVGDMNEERLAHARAMGFETVDLSKD
ASLGEQIEQILGVPEIDCAVDCVGFEAHGHGSSGHSEEAPATVLNSLMEITRPAGAIGIP
GLYVTDDPGAKDKAAQHGSLSIRFGLGWAKSHSFFTGQTPVLKYNRNLMQAILFDRLPIA
KIVNVEVISLDQAPEGYKKFDGGAPRKFVIDPHGLLAA
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgagcagcaatcgaggtgtcgtctatcttggcccgggcaaggtcgaagtacagaagatc
gattatccgaaaatggtcgatccgaccggccgagcgatcggccacggtgtgatcctgaaa
gtggtgagcacgaacatctgcggttccgaccagcacatggtgcgcggccgcacgaccgcc
ccggtcggcctcgtgctcggtcacgagatcaccggcgaagtggtcgaggtgggccgcgac
gtcgagacgctgaagctcggcgatctcgtgtcggtgccgttcaacgtcgcgtgcggccgc
tgcgcgatgtgcaaggacacgcatacgggcgtatgcctgaacgtgaacccgtcgcgtgcc
ggcggcgcatacggctacgtcgacatgggcggctggatcggcggccaggccgagtacgtg
ctcgtgccgtacgcggacttcaacctgctgaaattccccgaccgcgatcaggcaatggcg
aagattcgcgacctgacctgcctgtccgacattctgccgaccggttatcacggcgcggtg
agcgcgggcgtgaagccgggctcgacggtctatatcgcgggcgcgggcccggtcgggatg
gcggcggccgcgtcggcgcgcctgctgggcgcggcggtgaccatcgtcggcgacatgaac
gaggaacgcctcgcgcatgcgcgggcgatgggcttcgagacggtcgacctgtcgaaggac
gcgtcgctcggcgagcagatcgagcagattctcggcgtgccggaaatcgactgcgcggtc
gactgcgtcggcttcgaggcgcacggccacggttcgtcgggccattccgaggaagcgccc
gcgacggtgctgaactcgctgatggaaatcacgcgaccggccggcgcgatcggtatcccg
ggcctgtacgtgacggacgatccgggtgcgaaggacaaggccgcgcagcatggcagcctg
agcatccgcttcggcctcggctgggcgaagtcgcactcgttcttcacgggccagacgccg
gtgctgaagtacaaccgcaacctgatgcaggcaatcctgttcgaccgtctgccgatcgcg
aagatcgtcaacgtcgaggtgatctcgctcgaccaggcgccggaaggctacaagaagttc
gacggcggcgcgccgcgcaaattcgtgatcgatccgcacggtttgctggcggcctga

DBGET integrated database retrieval system