KEGG   Burkholderia ambifaria AMMD: Bamb_4644Help
Entry
Bamb_4644         CDS       T00398                                 

Definition
agmatinase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
bam  Burkholderia ambifaria AMMD
Pathway
Arginine and proline metabolism
Metabolic pathways
Module
Polyamine biosynthesis, arginine => agmatine => putrescine => spermidine
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:bam00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:1618406..1619395
Genome map
AA seq 329 aa AA seqDB search
MIRQPHIGRDTMNDHTHFQPLGGNEMPRCGGIATMMRLPHVASAAGLDACFVGVPFDLGT
SNRTGARFGPRQIRTESVLLRPYNMATRAAPFDSLQIADIGDVAINPYNLHDSIARIEAA
YDAILEHDCKPITLGGDHTIALPILRAIHRKHGKVALIHVDAHADVNDTMMGEKIAHGTP
FRRAVEEGLLHGDKVTQIGLRGTGYAAEDFDWCREQGFRVVQAEECWNKSLAQLMGEVRA
RVGDTPVYISFDIDGIDPAYAPGTGTPEIAGLTVPQALEIIRGAKGLNIVGCDLVEVAPP
YDPFGTTALLGANLAYELLCVLPGVAYRD
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgatacggcaaccccacatcggaagagacaccatgaacgaccacacccatttccagccg
ctcggcggcaatgaaatgccgcgctgcggcggcatcgcgacgatgatgcgcctgccgcac
gtggcgagcgccgcgggcctcgacgcctgcttcgtcggcgtgccgttcgatctcggcacc
tccaaccgcaccggcgcacgcttcggcccgcgccagatccgcaccgaatccgtgctgctg
cgcccgtacaacatggccacgcgcgccgcgccgttcgattcgctgcagatcgccgatatc
ggcgacgtcgcgatcaacccgtacaacctgcacgattccatcgcgcgcatcgaggctgca
tacgacgcgatcctcgagcacgactgcaagccgatcacgctcggcggcgaccatacgatc
gcgctgccgatcctgcgcgcgatccaccgcaagcatggcaaggttgcattgatccacgtc
gatgcgcacgccgacgtgaacgatacgatgatgggcgaaaagatcgcgcacggcacgccg
ttccgccgcgcggtcgaggaaggcctgctgcacggcgacaaggtcacgcagatcggcctg
cgcggcaccggctacgcggcggaggatttcgactggtgccgcgagcagggcttccgcgtg
gtccaggccgaggaatgctggaacaagtcgctcgcgcagctgatgggagaagtgcgcgcg
cgcgtcggcgacacgcccgtctacatcagcttcgacatcgacggcatcgatccggcctac
gcgcccggcaccggcacgccggaaatcgccggcctcacggtgccgcaggcgctcgagatc
atccgcggcgcgaaggggctgaacatcgtcggctgcgatctcgtcgaagtcgcgccgccg
tacgacccgttcggcaccacggcgctgctcggcgcgaacctcgcctacgagctgctgtgc
gtgctgcccggcgtcgcataccgcgactga

DBGET integrated database retrieval system