KEGG   Burkholderia ambifaria AMMD: Bamb_4717Help
Entry
Bamb_4717         CDS       T00398                                 

Definition
beta-ketoadipyl CoA thiolase (EC:2.3.1.9)
Orthology
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bam  Burkholderia ambifaria AMMD
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Two-component system
Class
Metabolism; Overview; Carbon metabolism [PATH:bam01200]
Metabolism; Overview; Fatty acid metabolism [PATH:bam01212]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:bam00620]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:bam00630]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:bam00640]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:bam00650]
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:bam00071]
Metabolism; Lipid metabolism; Synthesis and degradation of ketone bodies [PATH:bam00072]
Metabolism; Amino acid metabolism; Valine, leucine and isoleucine degradation [PATH:bam00280]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:bam00310]
Metabolism; Amino acid metabolism; Tryptophan metabolism [PATH:bam00380]
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:bam00900]
Metabolism; Xenobiotics biodegradation and metabolism; Benzoate degradation [PATH:bam00362]
Environmental Information Processing; Signal transduction; Two-component system [PATH:bam02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:complement(1708737..1709957)
Genome map
AA seq 406 aa AA seqDB search
MRPETLMTEAFLCDAIRTPIGRYGGALSGVRADDLGAVPLKALVERNRDVDWTAIDDVIY
GCANQAGEDNRNVARMSALLAGLPEGVPGSTINRLCGSGMDAVGVAARAIKSGEAALMVA
GGVESMTRAPFVMGKAASAFARQADIYDTTIGWRFVNPLMKQLHGVDSMPETGENVAVDY
NISRADQDLFALRSQQKAARAQQDGTLAEEIVSVTIPQKKGDPVVFSRDEHPRETSLEAL
AKLKGVVRPDGSVTAGNASGVNDGAAALLLANEATAKRFGLTPRARVLGIATAGVAPRVM
GIGPAPATQKLLARLGMTIDQFDVIELNEAFASQGLAVLRMLGVADDDPRVNPNGGAIAL
GHPLGASGARLVTTAMYQLHRTNGRFALCTMCIGVGQGIAIAIERV
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atgagaccggagacactgatgaccgaagcttttctgtgtgatgcgattcgtaccccgatc
ggccgttacggcggcgcgctgtccggcgtgcgcgccgacgacctcggcgcggtgccgctc
aaggcgctcgtcgagcgcaaccgcgacgtcgactggacggcgatcgacgacgtgatctac
ggctgcgcgaaccaggccggcgaggacaaccgcaacgtcgcgcgcatgtccgcgctgctc
gcgggcctgccggagggcgtgccgggttcgacgatcaaccgcctgtgcggttccgggatg
gacgcggtcggcgtggccgcgcgcgcgatcaagtcgggcgaggccgcgctgatggtggcc
ggcggcgtcgaaagcatgacgcgcgcgccgttcgtgatgggcaaggccgccagcgcattc
gcgcgccaggccgacatctacgacacgacaatcggctggcgtttcgtcaatccgctgatg
aaacagctgcatggcgtggattcgatgccggagacaggcgagaacgtcgcggtcgactac
aacatcagccgcgccgatcaggatctgtttgcgctgcgcagccagcagaaggccgcgcgt
gcgcaacaggacggcacgctcgccgaggaaatcgtatcggtcacgattccgcagaagaag
ggcgatccggtcgtcttttcgcgtgacgagcatccgcgcgaaacgtcgctcgaagcgctc
gcgaagctgaagggcgtcgtgcgtccggacggctcggtcacggccggcaacgcgtcaggc
gtcaacgacggcgccgctgcgctgctgctcgcgaacgaggccaccgcgaagcgcttcggc
ctgacgccgcgcgcccgcgtgctcggcatcgcgacggccggcgtcgcgccgcgcgtgatg
ggcatcggccccgcgccggccacgcagaagctgctcgcgcggctcgggatgacgatcgac
cagttcgacgtgatcgagctgaacgaagcgttcgcgtcgcagggtctcgcggtgctgcgc
atgctcggcgtcgccgacgacgaccctcgcgtgaacccgaacggcggcgcgatcgcgctc
ggccatccgctcggcgcgtcgggcgcgcgtctggtcacgaccgcgatgtaccagctgcat
cgcaccaacggccgcttcgcgctgtgcacgatgtgcatcggcgtcggccaaggcatcgcg
atcgcgatcgaacgcgtgtga

DBGET integrated database retrieval system