KEGG   Burkholderia ambifaria AMMD: Bamb_4931Help
Entry
Bamb_4931         CDS       T00398                                 

Definition
beta-galactosidase (EC:3.2.1.23)
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
bam  Burkholderia ambifaria AMMD
Pathway
Galactose metabolism
Brite
KEGG Orthology (KO) [BR:bam00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Bamb_4931
Enzymes [BR:bam01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     Bamb_4931
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:1940844..1942835
Genome map
AA seq 663 aa AA seqDB search
MRLGVCYYPEHWPESMWADDARRMKALGIAQVRIAEFAWSRIEPSPGEYDWGWLDRAVDV
LGAAGLEIVMCTPTATPPKWLVDRHPDILAIGADGRPRGFGSRRHYDFSSPTYLEASRQI
CTAVAERYGRHPAVRYWQTDNELGCHQTVVSYSPAALVRFREWLKARYGTIDVLNRAWGT
VFWSMEYRHFDEVDAPIGTVTEAHPSHRLDYRRFASDEVARYHRMQVDVIRAHSPGRPVA
HNFMQLFTEFDHYEVARDLDIATWDSYPLGALEEQWFAPELKARWLRTGHPDFASFNHDL
YRGMSKLPFWVMEQQPGPVNWAQWNPAPLPGMVRLWSWEAFAHGAGCVSYFRWRQAPFAQ
EQMHAGLHTPDDQLDEGGREAQRVAREIAAVLDAGADADANGAVRAPVALVFDYEAKWLF
EVQPQGADFHYPRCAFEYYSALRSLGLDVDVISAHAPLDGYRLVVVPPLPIVPDDFAARL
AASGAHAVFGPRTGSKTADLQIPPTLPPGPLASILPLRVWRVESLRPNVTEPIDGRLRDG
SAFTGDARRWRDLVELHDDAHSVVRARFADGHPACVSHGALHYWAALFDDATTARLFADV
AAEAGLTPSPLGDGVRVSRRGGLTYVFNYGGTPHMLDGVPPSAFVVGAAQVEPQGVAVYR
SRS
NT seq 1992 nt NT seq  +upstreamnt  +downstreamnt
atgcgcctcggagtctgttactacccggaacactggccggaatcgatgtgggccgacgac
gcccgccggatgaaggcactcggcatcgcgcaggtgcggatcgccgaattcgcgtggagc
cgcatcgagccgtcgccgggcgaatacgactggggctggctcgaccgcgcggtcgacgtg
ctcggcgcggccggcctcgagatcgtgatgtgcacgccgaccgcgacgccgccgaaatgg
ctcgtcgaccgtcaccccgacatcctcgcgatcggcgcggatggccggccgcgcgggttc
ggttcgcgccgccactacgacttctcgtcgccgacctatctcgaagcgtcgcgccagatc
tgcacggcggtcgccgaacgctacggccgccacccggccgtccgttactggcagaccgac
aacgagctcggctgccaccagacggtcgtcagctattcgccggccgcgctcgtgcgcttt
cgcgaatggctgaaggcgcgctacggcacgatcgacgtgctgaaccgcgcgtggggcacc
gtgttctggagcatggagtaccggcatttcgacgaagtcgacgcgcccatcggcaccgtg
accgaagcgcatccgtcgcatcgcctcgactaccggcgcttcgcgtccgacgaggtcgcg
cgctatcaccggatgcaggtcgacgtgatccgcgcgcattcgccaggccggcccgtcgcg
cacaacttcatgcagctgttcaccgagttcgatcattacgaagtggcgcgcgacctcgac
atcgcgacgtgggacagctatccgctcggcgcgctcgaggagcaatggttcgcgcccgag
ctgaaggcgcgctggctgcgcaccggccatccggatttcgcgtcgttcaatcacgatctc
tatcgcgggatgtcgaagctgccgttctgggtgatggagcagcagccggggcccgtgaac
tgggcgcagtggaaccccgcgccgctgccgggcatggtgcgcctgtggagctgggaagcg
ttcgcgcacggcgccggctgcgtgtcgtacttccgctggcggcaggcgccgttcgcgcag
gagcagatgcatgcgggcctgcacacgccggacgaccagctcgacgaaggcggccgcgaa
gcgcagcgcgtcgcgcgcgaaatcgccgccgtgctcgacgccggcgccgatgccgacgcg
aacggcgcggtgcgcgcccccgtcgcgctggtgttcgactatgaagcgaagtggctcttc
gaagtgcagccgcaaggcgccgatttccactacccgcgctgcgcgttcgagtactactcg
gcgctgcgttcgctcggcctcgacgtcgacgtgatctccgcgcatgcgccgctcgacggc
taccggctcgtcgtcgtgccgccgctgccgatcgtgccggacgacttcgcggcacggctc
gccgcatcgggcgcgcatgcggtgttcggcccgcgcaccggttcgaagaccgccgacctg
cagattccgccgacgctgccgcccggcccgctcgcgtcgatcctgccgctgcgcgtgtgg
cgcgtcgagtcgctgcggccgaacgtgaccgagccgatcgacggcaggttgcgcgacggc
tcggcgttcaccggcgacgcacgccgctggcgcgacctcgtcgagctgcacgacgacgcc
cacagcgtcgtgcgcgcgcgcttcgccgacggtcatccggcctgcgtgtcgcacggcgcg
ctgcactactgggccgcgctgttcgacgacgcgaccaccgcgcgcctgttcgccgacgtc
gcggccgaagccggcctgacaccgtcgccgctcggcgacggcgtgcgcgtgagccgacgc
ggcggcctgacctacgtattcaactatggcggcacgccgcacatgctcgatggggtgccg
ccgtccgcgttcgtggtcggcgccgcgcaggtcgagccgcaaggcgtcgccgtgtatcga
agccgttcgtag

DBGET integrated database retrieval system