KEGG   Burkholderia ambifaria AMMD: Bamb_4942Help
Entry
Bamb_4942         CDS       T00398                                 

Definition
malate synthase G (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
bam  Burkholderia ambifaria AMMD
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:bam00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Bamb_4942
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Bamb_4942
   00630 Glyoxylate and dicarboxylate metabolism
    Bamb_4942
Enzymes [BR:bam01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Bamb_4942
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:1954397..1956571
Genome map
AA seq 724 aa AA seqDB search
MIDQAGLQVAPALSQFIENEALPGTGIDKAAFWSGFSALVHDLAPRNRELLAERDRLQHE
LDTWHRAHPGPVRDHAAFRAFLEQIGYLVPVPANVAAATANVDSEIATQAGPQLVVPLSN
ARYALNAANARWGSLYDALYGTDALPEDGGAERTSAYNPTRGQRVIDYARNVLDNAAPLA
SGSHRDALRYRVEDGQLAVETGKGVVHLAHPAQFVGYQGAAGAPSAILLKNNGLHIEIQI
DASTPIGRADLANVKDVVLEAAVSTIIDCEDSVAAVDAEDKVQLYRNWLGLMQGTLVEEV
AKGGKTFTRRLNADREYTTPAGGTLSLHGRSLLFVRNVGHLMTNGAVLDRDGNEIPEGIL
DGVVTTLCALHDLKAKRNSRTGSIYIVKPKMHGPVEVAFADTLFARIEDLYGLPRNTLKM
GIMDEERRTSVNLAACIAAAAARVAFINTGFLDRTGDEMHTAMEAGPMIRKGEMKSSAWI
TAYERNNVLAGLSAGLRGRAQIGKGMWAMPDLMHAMLEQKIAHPRAGANTAWVPSPTAAT
LHALHYHQVDVQAVQQELEKTSYASERDALLEGLLTVPVVERAAWSESEILSEVENNAQG
ILGYVVRWVEQGVGCSKVPDIHDVGLMEDRATLRISSQHIANWLRHGVITEAFVLDVFKR
MARVVDQQNAGDPNYRPMAPDYGQSTAFKAACALALQGTSQPSGYTEPLLHRFRLAFKAQ
QQGA
NT seq 2175 nt NT seq  +upstreamnt  +downstreamnt
atgatcgaccaagcaggactgcaagtcgcgccagcgctgagccagttcattgaaaacgaa
gcattgccgggcaccggtatcgacaaggccgcgttctggagcggtttctcggcgctggtg
cacgacctcgcgccgcgcaaccgcgagttgctcgcggaacgcgaccgcctccagcacgaa
ctcgacacgtggcatcgcgcgcatcccggcccggtgcgcgaccatgccgcgtttcgcgcg
ttcctcgaacaaatcggctacctcgtgccggtcccggcgaacgtcgcggcagccaccgcg
aacgtcgacagcgagatcgcgacgcaggccggcccgcagctcgtcgtgccgctgtcgaac
gcgcgctatgcgctgaacgccgcgaacgcacgctggggcagcctgtacgacgcgctgtac
ggcaccgatgcgctgccagaggacggcggcgccgaacgcacgtcggcctacaacccgaca
cgcggccagcgcgtgatcgactacgcgcgcaacgtgctcgacaacgcggcgccgctcgcg
agcggctcgcaccgcgacgcgctgcgctatcgcgtggaggacggccagctcgccgtcgag
acgggcaagggcgtcgtgcacctcgcgcacccggcgcaattcgtcggctaccagggcgcg
gcgggcgcgccgtccgcgatcctgctgaaaaacaacggcctgcacatcgagatccagatc
gacgcgtcgacccccatcggtcgcgccgatctcgcgaacgtgaaggacgtcgtgctcgaa
gccgcggtcagcacgatcatcgactgcgaggattcggtcgcggcggtcgatgccgaagac
aaggtccagctgtatcgcaactggctcgggctgatgcagggcacgctggtcgaggaagtc
gcgaagggcggcaagaccttcacgcgccgcctgaacgccgatcgcgaatacacgacgccg
gccggcggcacgctgtcgctgcacggccgctcgctgctgttcgtgcgcaacgtcggccac
ctgatgaccaacggcgcggtgctcgaccgcgacggcaacgagattccggaagggattctc
gacggcgtcgtcaccacgctgtgcgcgctgcacgacctgaaggccaagcgcaattcgcgc
acgggctcgatctacatcgtgaagccgaagatgcacggccccgtcgaagtcgcgttcgcc
gacacgctgttcgcgcgcatcgaggatctgtacggcctgccgcgcaacacgctgaagatg
ggcatcatggacgaggagcgccgcaccagcgtgaacctcgccgcatgtatcgcggccgcc
gccgcgcgcgtcgcgttcatcaacaccggcttcctcgaccgcaccggcgacgagatgcac
accgcgatggaagcgggcccgatgatccgcaagggcgagatgaagtcgtcggcgtggatc
accgcatacgagcgcaacaacgtgctcgcgggcctgtcggccggcttgcgcggccgcgcg
cagatcggcaagggcatgtgggcgatgccggacctgatgcacgcgatgctcgagcagaag
atcgcgcatccgcgcgccggcgcgaacaccgcgtgggtgccgtcaccgaccgccgcgacg
ctgcacgcgctgcactaccaccaggtcgatgtgcaggccgtccagcaggagctggagaag
acgtcctacgcgagcgaacgcgacgcgctgctcgaagggctgctgaccgtgccggtcgtc
gagcgcgccgcctggagcgaaagcgagatcctgagcgaggtcgagaacaacgcgcagggc
atcctcggctacgtggtgcgctgggtcgaacagggcgtcggctgctcgaaggtgcccgac
atccacgacgtcggcctgatggaagaccgcgcgacgctgcgcatctcgagccagcacatc
gcgaactggctgcgccatggcgtgatcaccgaggcgttcgtgctcgacgtgttcaagcgg
atggcgcgcgtcgtcgaccagcagaacgcgggcgacccgaactaccgcccgatggcgcct
gactacggccagtccaccgcgttcaaggccgcgtgcgcgctggcgctgcagggcacgtcg
cagccgagcggttataccgagccgctgctgcatcggttccggctcgcgttcaaggcgcaa
caacagggcgcgtga

DBGET integrated database retrieval system