KEGG   Burkholderia ambifaria AMMD: Bamb_5592Help
Entry
Bamb_5592         CDS       T00398                                 

Definition
glycogen branching protein (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
bam  Burkholderia ambifaria AMMD
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:bam00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3:23639..25840
Genome map
AA seq 733 aa AA seqDB search
MTDMLFDRTDIDALLAGRHPDPFACLGPHTDAGRVVVRALLPGAQRVRAVTPDGDELGAL
ACVDDAGCFAGTLAHDGRYRLAIDWPDTRQITDDAYAFGTLLDEAALARFAAGDPAAVLD
CLGATPTRVDGVDGVRFAVWAPNAQRVSVVGDFNMWDGRRHPMRLRRPWGVWELFVPGIG
AGEHYKYELRAADGHVLPHKADPCARATEAPPRTASVVADTAALDAFAWHDDGWLHARPP
ADQRFRMPWSIYEVHAESWQRVPEDMDRSANWDELAERLIPYVRGMGFTHVEFMPISEYP
FGGSWGYQPLAQFAPSARFGPVDGFARFVDRAHAAGIGVIVDWVPAHFPNDAHGLAQFDG
SALYEHADPREGMHPDWNTCVFNLGRNEVSAFLIASALAWARRYHVDGIRVDAVASMLYR
DYSRNEGEWVPNIHGGRENLESVAFLRALNDTLHGTLAPPGVVTFAEESTAWPGVTASTG
DGGLGFDFKWNMGWMHDTLSYVREDPIHRRYHHDRMTFGLVYAFSERFVLPLSHDEVVHG
KGSLAVKMPGDAWQRLATLRAYFGFMWAHPGKKLLFMGSEFAQWAEFAHDATPHWDLLDA
PAHRGVQRLVRDLNRTYAAEPALHALDCHASGFFWLIGDDRDNSVFAFARRDDSGRLVVA
ICNFTPVPRPGYRIGLPAPGHWRELMNTDAAVYGGTNAGNDGAVWTEDVPSHGQSWSATL
RLPPLATLWLSPA
NT seq 2202 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacatgctgttcgaccgcaccgacatcgacgcgctgctcgccggccgccatccg
gacccgttcgcgtgtctcggcccgcacacggacgccggccgggtcgtcgtgcgcgcgctg
cttcccggtgcgcagcgcgtgcgcgcggtgacgcccgacggcgacgaactcggcgcgctc
gcatgcgtcgacgacgccggctgcttcgcgggcacgctcgcgcacgacggccgctaccgg
ctggccatcgactggccggacacacgccagatcaccgacgacgcgtatgcgttcggcacg
ctgctcgacgaggccgcgctcgcgcgtttcgcggccggcgacccggccgccgtgctcgac
tgcctgggcgcgacgcccacgcgcgtcgacggcgtcgacggcgtgcgcttcgcggtgtgg
gcgccgaacgcgcagcgcgtatcggtcgtcggcgacttcaacatgtgggacggccgccgg
catccgatgcggttgcgccggccgtggggcgtgtgggagctgttcgtgccgggcatcggc
gccggcgaacactacaagtacgagctgcgcgcggccgacggacacgtgctgccgcacaag
gccgacccgtgcgcgcgcgcgaccgaagcaccgccgcgcaccgcgtccgtggtcgccgac
accgcggcgctcgacgcgttcgcgtggcacgacgacggctggctgcacgcgcggccgccc
gcggaccagcgctttcgcatgccatggtcgatctacgaggtacatgcggaatcgtggcag
cgcgtgcccgaggatatggatcgcagcgcgaactgggacgaactcgccgagcggctgatc
ccgtacgtgcgcggcatgggcttcacgcacgtcgaattcatgccgatttccgaatacccg
ttcggcggttcgtggggctatcaaccacttgcgcagttcgcgccgtcggcgcgcttcggg
cccgtggacggcttcgcgcgcttcgtcgaccgcgcgcacgcggccggcatcggcgtgatc
gtcgactgggtgcccgcgcacttcccgaacgacgcgcacggcctcgcgcaattcgacggc
agcgcgctgtacgaacacgccgatccgcgcgaaggcatgcacccggactggaacacctgc
gtgttcaacctcggacgcaacgaggtcagcgcattcctcatcgcgtcggcgctcgcgtgg
gcgcgccgctatcacgtcgacgggatccgcgtcgacgcggtcgcgtcgatgctgtaccgc
gactattcgcgcaacgaaggcgaatgggtgccgaacatccacggcgggcgcgagaatctc
gaatccgtcgcgttcctgcgcgcgctcaacgacacgctgcacggtacgctcgcgccgccg
ggcgtcgtcaccttcgcggaggaatcgaccgcgtggccgggcgtcacggcgtcgaccggc
gacggcgggctcggcttcgacttcaaatggaacatggggtggatgcacgacacgctgtcg
tatgtgcgcgaggatccgatccatcgccgctatcaccacgaccggatgacgttcgggctc
gtctatgcgttctccgaacgattcgtgctgccgctgtcgcacgacgaggtcgtgcacggc
aagggctcgctcgccgtgaagatgccgggcgacgcgtggcagcggctcgcgacgctgcgc
gcgtacttcggcttcatgtgggcgcatccgggcaagaagctgctgttcatgggcagcgaa
ttcgcgcaatgggcagagttcgcgcacgatgcgacgccgcactgggatctgctcgacgca
cccgcgcatcgcggcgtgcagcggctcgtgcgcgacctgaaccgcacctacgcggccgag
ccggcgctgcacgcgctcgactgtcacgcgtccggctttttctggctgatcggcgacgat
cgcgacaacagcgtattcgcgttcgcgcgccgcgacgatagcgggcgcctcgtcgtcgcg
atctgcaacttcacgccggtgccgcgccccggctatcgcatcgggctgcccgcgcccggg
cactggcgcgaactgatgaacaccgatgccgccgtgtacggcggcacgaatgccggcaac
gacggcgccgtgtggacggaagacgtgccctcgcacggccagtcgtggtcggcgaccttg
cgcctgcccccgctcgcgaccctatggctgagcccggcctga

DBGET integrated database retrieval system