KEGG   Burkholderia ambifaria AMMD: Bamb_5595Help
Entry
Bamb_5595         CDS       T00398                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
bam  Burkholderia ambifaria AMMD
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bam00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Bamb_5595
Enzymes [BR:bam01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     Bamb_5595
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3:29867..32098
Genome map
AA seq 743 aa AA seqDB search
MTTDVPIAELARAAGLEPDWIDAGGVARRVTDDSLVALVDALGWPCGTPIERVDSAAALV
DAHDAAPPVVTGDAGVPLTLPRSVAPRGARWRITLESGEHVDGRVAGAGEYGRLPPLAQP
GYHTLDIGEHRIGLAIAPPRARPFAAGDGLPDAQRRWGISAQLYSLRRAGDDGAGDYTAL
ARLAAQAARHGADAVAISPTHAGYPALPEHNSPYSPSSRRWHNVAYLDCDAVPGADVVRR
TNGAAADVASAPDTPLIDWPQVLPQKLRRLRACFDAWRANGEPARDAFEQFRAAGGAALD
AHARFDALQAFCIEHGIGADWRHWPAQWRMPATAEVDAFAHAHADAIAFHTFLQWCASRA
LGDAQQAARDAGMAVGLIADLAVGSDRAGSDAWAHGTTLLRGVSVGAPPDLFNADGQAWG
VTTWTPAALRANGFTPFLDLLRAAFAHAGGIRIDHVLGFARMWIVPEGGSARDGAYLRYP
LDDLVRLVALEAARHRAVAIGEDLGTVPAGFRERLGAQGIAGMRVLWFERDADRAFRPPS
AWDRDTIAMTSTHDLPTVAGWWRGIDLEWRRVAAEAAAAPTKPHPAGDDVGRAAAAHDTG
HDARIDPVLRGDAPAADDGHDAPPPASFDLRAAQDERTTDRAALWRALQHAGCAPAGDPI
PSADTPPVGAVLAYVARSPSPLAIVPLEDLLALDEQPNLPGPPCGHPNWLRRLPRAVDAL
LDADARTRITAIEHARRAPEDDA
NT seq 2232 nt NT seq  +upstreamnt  +downstreamnt
atgacgaccgacgtaccgatcgccgaactcgcgcgcgcggccgggctcgaacccgactgg
atcgacgcgggcggcgtcgcgcggcgcgtgaccgacgattcgctcgtcgcgctcgtcgat
gcgctcggctggccctgcggcacgccgatcgagcgggtcgacagcgcggcggccctcgtc
gatgcgcacgacgccgcgccgccggtcgtgacgggcgacgcgggcgtgccgctgacgctg
ccgcgcagcgtcgcgccgcgcggcgcgcgctggcggatcacgctggaatcgggcgagcac
gtcgacgggcgcgtggccggcgcgggcgaatacggcaggctgccgccgctcgcgcagccc
ggctatcacacgctcgacatcggcgagcaccgcatcgggctcgcgatcgcgccgccgcgc
gcgcggccgttcgccgctggcgacggcctgccggatgcgcagcgccgctggggcatctcg
gcccagctctacagcctgcggcgcgcgggcgacgacggtgcgggcgactacaccgcactc
gcgcgcctcgccgcgcaggccgcgcggcacggggccgatgcggtcgcgatcagcccgacg
catgccggctatccggcgctgcccgagcacaacagcccgtattcgccgtcgtcgcggcgc
tggcacaacgtcgcgtatctcgactgcgatgccgtaccaggcgccgatgtcgtgcggcgc
acgaacggcgcggcggcggacgtcgcatccgcaccggatacgccgctgatcgactggccg
caggtgctgccacagaaactgcgacgcctgcgcgcgtgcttcgatgcgtggcgtgcgaac
ggcgaacctgcgcgcgacgcgttcgagcagtttcgcgcggcgggcggtgcggcactcgac
gcgcatgcgcgcttcgacgcgctgcaggcgttctgcatcgaacacgggattggcgcggac
tggcggcactggcccgcgcaatggcggatgccggccaccgccgaggtcgacgcattcgcg
cacgcgcatgccgacgcgattgcgttccatacgttcctgcaatggtgcgcgtcgcgcgcg
ctcggcgacgcgcagcaggcggcgcgcgatgccgggatggcggtcgggctgatcgccgac
ctcgcggtcggatccgatcgcgcgggcagcgacgcgtgggcgcacggcacgacgctgttg
cgcggcgtgtcggtcggcgcaccacccgacctgttcaatgcggacggccaggcgtggggc
gtgacgacgtggacaccggccgcgctgcgcgcgaacggcttcacgccgttcctcgacctg
ttgcgcgcggccttcgcccatgccggcgggattcgcatcgatcatgtgctcggcttcgcg
cggatgtggatcgtgccggaaggcggatcggcgcgcgacggcgcgtacctgcgttatccg
ctcgacgatctggtgcggctcgtcgcgctggaggccgcgcggcaccgggcggtggcgatc
ggcgaggatctgggcacggtgccggcgggttttcgcgagcggctcggcgcgcagggcatc
gccggaatgcgcgtgctgtggttcgaacgtgacgcggatcgcgcatttcgaccgccgtcg
gcgtgggatcgcgacacgatcgcgatgacgtcgacgcatgacctgccgaccgtggccggc
tggtggcggggtatcgatctcgaatggcggcgggtggcggccgaggccgctgcggcgccg
accaagccgcaccctgccggtgacgacgtcggccgcgccgcggccgcgcacgacaccggc
cacgacgcacggatcgatccggtcctgcgtggcgatgcgcccgccgcggatgacggccac
gacgcgccgccccccgcttctttcgacctccgcgccgcccaggacgagcgcaccaccgac
cgcgcggcgttgtggcgcgcgttgcagcacgcgggctgcgcaccggccggcgatccgatt
ccgtccgccgacacgccgcccgtcggcgcagtgctcgcatacgtcgcgcgcagcccgtcg
ccgctcgcgatcgtgccgctcgaggatctgctcgcgctcgacgagcaaccgaatctcccc
ggcccgccgtgcggtcatccgaactggctgcgccggctgccgcgcgcggtcgacgcgctg
ttagacgccgacgcgcgcacccgcattacggcgatcgagcacgcgcgccgagcgccggag
gacgacgcatga

DBGET integrated database retrieval system