KEGG   Burkholderia ambifaria AMMD: Bamb_5780Help
Entry
Bamb_5780         CDS       T00398                                 

Definition
dihydrokaempferol 4-reductase (EC:1.1.1.219)
Orthology
K00091  
dihydroflavonol-4-reductase [EC:1.1.1.219]
Organism
bam  Burkholderia ambifaria AMMD
Brite
Enzymes [BR:bam01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.219  dihydrokaempferol 4-reductase
     Bamb_5780
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3:252243..253316
Genome map
AA seq 357 aa AA seqDB search
MMNIDTDLPVMVTGATGYVAGWIVQRLLEAGVTVHAAVRHPDDPDKLKYLQRIAAGQPGT
IRYFRADLLDPGSYADAMAGCGTVFHTASPFTITVRDPQKELVDPALLGTRNVLDTVNRT
PSVRRVVLTSSCAAIYGDNADLDAVPSGVFTEANWNTSSSLTHQPYSYSKTVAEREAWQI
AGAQQRWRLVTINPSLVIGPGINPYATSESFEIVRQMGDGTMKMGVPDLGMGAVDVRDVA
DAHLRAAFLPDANGRYIVSGHNTSLPAMAATLLERYGADYPIPRRILPKWLVWSIGPLVN
KSVTRRVVARNVGLPWRADNARSRNELGIHYRPLAESMNDFFQQLIETGQLRRGSAS
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atgatgaatatcgataccgacctgccggtgatggtgaccggcgcaaccggctacgtcgcg
ggctggatcgtgcaacggttgctcgaagccggcgtgacggtgcatgcggccgttcgtcat
cccgacgatcccgacaagctcaaatatctgcagcgcatcgcggccggccagcccggcacg
atccgctatttccgcgccgacctgctcgacccgggatcgtatgcggacgcgatggccggt
tgcggcaccgtgttccataccgcgtcgccgttcaccattacggttcgtgaccctcagaaa
gaactcgtcgacccggcgctgctcggcacgcgcaacgtgctcgatacggtgaaccgcacg
ccgtcggtgcggcgcgtcgtgctgaccagcagctgcgccgcgatctacggcgacaacgcc
gatctcgacgcggtgccgagcggcgtattcaccgaggcgaactggaataccagttcgtcg
ctgacgcaccagccctattcgtattcgaagacggtggccgagcgcgaagcgtggcagatc
gccggcgcgcagcagcgctggcgtctcgtgaccatcaatccgtcgctcgtcatcgggccg
ggcatcaatccgtacgcgacgtcggagagcttcgaaatcgtccggcagatgggcgacggc
acgatgaaaatgggcgtgccggatctcggcatgggcgcggtcgacgtgcgcgatgtcgcc
gacgcgcacctgcgggccgcgttcctgccggacgcgaacggccgctacatcgtgtccggt
cacaacacgagcctgccggcgatggcggcgacgctgctcgaacggtatggcgccgactat
ccgatcccgcggcgcatcctgcccaaatggctcgtgtggtcgatcggcccgctggtgaac
aagagcgtgacgcgccgcgtcgtcgcccgcaatgtcggactgccgtggcgcgccgacaat
gcccgtagccgcaacgagctcgggatccactaccgcccgctcgccgagtcgatgaacgac
ttctttcagcagctgatcgaaaccggacagttgcggcgaggaagcgcttcgtga

DBGET integrated database retrieval system