KEGG   Burkholderia ambifaria AMMD: Bamb_6327Help
Entry
Bamb_6327         CDS       T00398                                 

Definition
beta-galactosidase (EC:3.2.1.23)
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
bam  Burkholderia ambifaria AMMD
Pathway
Galactose metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:bam00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3:929652..931622
Genome map
AA seq 656 aa AA seqDB search
MHLGVCYYPEHWPREQWARDARRMAELGLTRVRIAEFAWSRMEPEPGRYDWAWLDEAIDT
LASRQLKVILGTPTASPPKWLVDRHPEILPIGADGAVWQFGSRRHYDIASPVYREHCVRI
ADAMARRYGAHPAVIAWQTDNELGCHNTLPSYTCAALEGFRAWLAVRYGDIGALNRAWGN
VFWSMEYRGFDEIELPRHTPTDANPAHLLDFRRYQSDEVARFHAAQVDAIRPHAPGRDVL
HNFMGFFTEFDHYAFARGGLDVAAWDSYPVPRTEVLPLDEADKQRWARTGHPDVSAFSHD
LYRGVGNGRMWVMEQQAGPVNWGPYNPVPHAGAVRLWTWEAFAHGAELVSYFRWRQYPHA
QEQLHSGLNAPDDQLSPGGREVARVARELAALDPALVAGAREPARVALLFDYTADWMIRI
QPHGADFDYQQHAFDWYHALRELGLDVDIVAADADVSRYALVVVPTLPVVPDCVVEQAVR
GNAHWLFGPRTGSRTAEFAIVPGLAPGKLRDVLPVRIAQVESLRPSLAPRVAFDGVDGHA
LKWRDHIDLDASTSIVVLAACDDGVPALVRHGQVTMATACFDPALLRAIVGRCARDAGLP
VRELPDGVRLCRRGRVVFAFNYGDTPCTLPAPDGARFVLGGPELGAVDVAAWVEPD
NT seq 1971 nt NT seq  +upstreamnt  +downstreamnt
atgcacctcggcgtttgctactaccccgaacactggccgcgcgaacaatgggcgcgcgat
gcgcggcgcatggccgaactgggcctgacgcgcgtgcggatcgccgaattcgcatggagc
cggatggagccggaaccgggccgctacgactgggcgtggctcgacgaagcgatcgacacg
ctcgccagccgccagttgaaggtcatactcggcacgccgaccgcgtcgccgccgaaatgg
cttgtcgatcgccatccggagatcctgccgatcggcgcggacggcgcagtgtggcaattc
ggctcgcgtcgccattacgacatcgcgagccccgtgtatcgcgagcactgcgtgcgcatc
gcggacgcgatggcgcggcgctacggcgcgcatccggcggtgatcgcgtggcagaccgac
aacgagctcggctgtcacaacacgctgccgagctatacgtgtgcggcgctcgaaggcttt
cgcgcgtggctcgccgtgcgctacggcgacatcggcgcgctgaaccgcgcgtggggcaac
gtgttctggagcatggaatatcgcggcttcgacgagatcgagctgccacgccatacgccg
accgacgcgaaccccgcgcacctgctcgacttccggcgctatcagtcggacgaggtcgcg
cggttccatgcggcgcaggtcgatgcgatccgtccgcacgcgccgggccgcgacgtgctg
cacaacttcatgggatttttcaccgagttcgaccactacgcgttcgcgcgcggcggcctc
gatgtcgccgcgtgggacagctacccggtgccgcgcaccgaagtgctgccgctcgacgaa
gccgacaagcagcgctgggcacgcaccggccatcccgacgtgtcggcgttctcgcacgac
ttgtatcgcggtgtcggcaacggccggatgtgggtgatggagcaacaggcggggcccgtc
aactgggggccgtacaacccggtgccgcacgccggcgcggtgcggctgtggacgtgggaa
gcgtttgcgcacggcgcggagctcgtgtcgtatttccgctggcggcagtatccgcatgcg
caggagcagctgcactcggggctcaacgcaccggacgatcagctgtcgccgggcggccgt
gaagtggcgcgcgtcgcacgcgagctggccgcgctggaccccgcgctcgtcgccggcgcg
cgcgagccggcccgcgtcgcgctgctgttcgattacacggccgactggatgatccggatc
cagccgcacggtgccgacttcgactatcagcagcacgcgttcgactggtatcacgcgctg
cgcgaactggggctcgacgtcgatatcgtcgcggccgatgccgacgtgtcgcgctatgca
ctcgtcgtcgtgccgacgctgccagtcgtgccggattgcgtcgtcgagcaggccgtgcgc
ggcaacgcgcactggctgttcgggccacgcaccgggtcgcgcactgccgagttcgcgatc
gtgccgggcctcgcgccgggcaagctgcgcgacgtgctgccggtgcggatcgcgcaagtc
gagtcgctgcggccgtcgctcgcgccgcgcgtcgcgttcgacggtgtcgacggccatgcg
ctgaaatggcgcgatcacatcgacctcgacgcgagcacctccatcgtcgtgctcgctgcc
tgcgacgacggcgtgcccgcgctcgtgcggcacggtcaggtgacgatggcgactgcgtgc
ttcgatcccgcgctgttgcgcgcaatcgtcggccgctgcgcgcgcgatgccggactgccg
gtgcgcgaactgcctgacggcgtgcgcttgtgccggcgcgggcgcgtcgtgttcgcgttc
aactacggcgataccccgtgcacgctgcccgcgccggacggtgcgcgcttcgtgctcggc
ggccccgaactcggcgcggtcgatgtcgccgcatgggtcgagccggactga

DBGET integrated database retrieval system