KEGG   Burkholderia ambifaria AMMD: Bamb_6330Help
Entry
Bamb_6330         CDS       T00398                                 

Definition
(GenBank) aldose 1-epimerase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
bam  Burkholderia ambifaria AMMD
Pathway
bam00010  Glycolysis / Gluconeogenesis
bam00052  Galactose metabolism
bam01100  Metabolic pathways
bam01110  Biosynthesis of secondary metabolites
bam01120  Microbial metabolism in diverse environments
bam01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bam00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bamb_6330
   00052 Galactose metabolism
    Bamb_6330
Enzymes [BR:bam01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     Bamb_6330
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: ABI91874
UniProt: Q0B1U9
Position
3:complement(934309..935397)
Genome map
AA seq 362 aa AA seqDB search
MPIDIDTSRPAAELGRIPSEPWGTPPGGDPVRRYTLRNAHGMRVVISDLGATVVSWLAPD
RTGRFADIVLAHDTPADYIDSGAYLGATVGRWANRIADARFTLDGVDYTLDRNENGNLLH
GGASGFHRARWDVIDDHGGLTLRLDSPEGDAGFPGNVRVQVRYTLDDDGTLTIDYTGVTD
APTPLNLTNHSYFNLSGRAGSDVRGHLLQIDADAFVEVDDALIPTGTADVTGSAFDFRQS
APIGARLDWPHAQLARGRGFDHCYVLREPGRGVRPVAAIYDPESGRELAVSTDQRGLQLY
TGNYLDGVRASGGVSCVQHAALCVEAGFFPNQINMNALRDETILQPGDTYRQTTRYRVGV
RG
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgcctatcgatatcgacacttcccgcccggcagccgagctcggccgcattccgtccgag
ccgtggggcacgccgcccggcggcgatccggtgcggcgctatacgctgcgcaacgcgcac
ggaatgcgcgtcgtcatcagcgatctcggcgcgaccgtcgtgtcgtggctcgcccccgac
cgcaccgggcgcttcgccgatatcgtgctggcccatgacacgccggccgattacatcgac
tcgggcgcgtacctcggcgcgaccgtcggccgctgggcgaaccggatcgcggacgcgcgc
ttcacgctcgacggcgtcgactacacgctcgaccgcaacgagaacggcaacctgctgcac
ggcggcgcgagcggctttcatcgcgcgcgctgggacgtgatcgacgaccacggcgggttg
acgctgcggctcgattcgccggaaggcgatgccgggttccccggcaacgtgcgcgtacag
gtacgctacacgctcgacgacgacggcacgctgacgatcgactacacgggcgtgaccgat
gcgcccacgccgttgaacctgacgaatcacagctacttcaacctgagcggacgcgcgggc
agcgacgtgcgcgggcatctgctgcagatcgacgccgatgcgttcgtcgaagtggacgac
gcgttgatcccgaccggcacggccgacgtgacgggcagcgcgttcgatttccggcaaagc
gcgccgatcggcgcgcgccttgactggccgcatgcgcagctcgcccgcgggcgcggcttc
gaccactgctacgtgctgcgcgagcctgggcgcggcgtgcggcccgtcgcggcgatctac
gatccggaaagcggccgggaactcgccgtgtcgacggatcagcgcgggctgcagctctat
acgggcaactatctggacggcgtgcgcgcaagcggcggtgtgtcgtgcgtgcagcatgcg
gcgctgtgcgtcgaggccgggttctttccgaaccagatcaacatgaacgcgctgcgcgac
gaaaccatccttcagccgggcgacacctatcgccagacgacgcggtatcgggtcggcgtg
cgggggtag

DBGET integrated database retrieval system