KEGG   Burkholderia ambifaria AMMD: Bamb_6332Help
Entry
Bamb_6332         CDS       T00398                                 

Definition
xylose isomerase (EC:5.3.1.5)
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
bam  Burkholderia ambifaria AMMD
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bam00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Bamb_6332
   00051 Fructose and mannose metabolism
    Bamb_6332
Enzymes [BR:bam01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     Bamb_6332
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3:936884..938206
Genome map
AA seq 440 aa AA seqDB search
MSYFEHIPAIRYEGPQSDNPLAYHHYDAEKRVLGKTMAEHLRIAVCYWHTFVWPGHDIFG
QGAFQRPWQQPGDALERARLKADAAFEFFTKLGTPFYTFHDTDVAPEGDSLREYAANFAR
MVDYLGERQQASGVRLLWGTANLFSHPRFAAGAATNPNPDVFAWAATQVCHALDATHRLG
GENYVLWGGREGYETLLNTDLKRERDQFARFLSMVVEHKHRIGFKGALLIEPKPQEPTKH
QYDYDVATVHGFLVQYGLQNEIRVNIEANHATLAGHSFHHEIANAFALGVFGSVDANRGD
PQNGWDTDQFPNSVEELTLAFYEILRHGGFTTGGMNFDAKVRRQSVDPEDLFYGHVGAID
VLALALERAAVLVENDRLDALRRQRYAQWDDAFGQKILSGGYTLQSLADDALARGVDPRH
ASGAQERLENIVNQAIYGLR
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtatttcgaacacattcccgcgattcgttacgaaggtccgcagtcggacaacccg
ctggcctaccaccattacgacgccgagaagcgtgtgctcggcaagacgatggccgagcat
ctgcggattgccgtgtgctactggcacacgttcgtatggccggggcacgacatcttcggg
cagggcgcattccagcggccctggcagcaacccggcgacgcactcgagcgggcgcggctg
aaggccgatgcggcattcgaattcttcacgaagctcggtacgccgttctatacgttccat
gacacggacgtcgcgccggagggcgacagcctgcgcgagtacgcggccaatttcgcgcgg
atggtcgactatctcggcgagcgccagcaggcgagcggcgtgcggctgctgtgggggacc
gcgaacctgttctcgcacccgcgcttcgcggcgggcgcggcgacgaacccgaaccccgac
gtgttcgcgtgggccgcgacccaggtgtgccatgcgctcgacgcaacgcaccggctcggc
ggcgagaactacgtgctgtggggcggccgcgaagggtacgagacgctgctcaataccgac
ctgaagcgcgagcgcgaccagttcgcgcgcttcctgtcgatggtcgtcgagcacaagcac
cggatcggcttcaagggcgcgctgctgatcgagccgaagccgcaggagccgaccaagcac
cagtacgactacgacgtcgcgaccgtgcacggcttcctcgtgcagtacggactgcagaac
gagatccgcgtgaacatcgaggcgaaccacgcgacgctcgccggtcattcgttccatcac
gagatcgcgaatgcgttcgcgctcggcgtgttcggcagcgtcgacgcgaaccgcggcgat
ccgcagaacggctgggacaccgaccagtttccgaacagcgtcgaggaactgacgctcgcg
ttctacgagatcctgcgccacggcggctttaccaccggcgggatgaacttcgacgcgaag
gtgcgccgccagagcgtcgatccggaagacctgttctacggccatgtcggcgcgatcgac
gtgcttgcgctcgcgctcgaacgcgcggcggtgctggtcgagaacgaccggctcgacgcg
ctgcgccggcagcgctacgcgcagtgggacgatgcgttcggccagaagatcctgtcgggc
ggctatacgctgcagtcgctcgcggacgacgcgctcgcgcgcggcgtggacccgcggcat
gcgagcggcgcgcaggagcggctcgagaacatcgtgaaccaggcgatctacgggctgcgc
tga

DBGET integrated database retrieval system