KEGG   Bacillus amyloliquefaciens subsp. plantarum UCMB5033: RBAU_0300Help
Entry
RBAU_0300         CDS       T02795                                 

Gene name
amyE
Definition
AmyE alpha-amylase (EC:3.2.1.1)
Orthology
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
bama  Bacillus amyloliquefaciens subsp. plantarum UCMB5033
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bama00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    RBAU_0300 (amyE)
Enzymes [BR:bama01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     RBAU_0300 (amyE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
331238..333217
Genome map
AA seq 659 aa AA seqDB search
MFEKRFKTSLLPLFAGFLLLFHLVLSGPAAANAETANKSNKVTASSVKNGTILHAWNWSF
NTLTQNMKDIRDAGYAAIQTSPINQVNEGNQGDKSMRNWYWLYQPTSYQIGNRYLGTEQE
FKDMCAAAEKYGVKVIVDAVINHTTSDYGAISDEIKRIPNWTHGNTQIKNWSDRWDVTQN
SLLGLYDWNTQNTEVQVYLKRFLERALNDGADGFRYDAAKHIELPDDGNYGSQFWPNITN
ISAEFQYGEILQDSASRDTAYANYMNVTASNYGHSIRSALKNRNLSVSNISHYASDVSAD
KLVTWVESHDTYANDDEESTWMSDDDIRLGWAVIGSRSGSTPLFFSRPEGGGNGVRFPGK
SQIGDRGSALFKDQAITAVNQFHNVMAGQPEELSNPNGNNQIFMNQRGSKGVVLANAGSS
SVTINTSAKLPDGRYDNRAGAGSFQVANGKLTGTINARSAAVLYPDDIGNAPHVFLENYQ
TEAVHSFNDQLTVTLRANAKTTKAVYQINNGQQTAFKDGDRLTIGKGDPIGTTYNIKLTG
TNGEGAARTQEYTFVKKDPSQTNIIGYQNPDHWGQVNAYIYKHDGGRAIELTGSWPGKAM
TKNADGMYTLTLPENADTANAKVIFNNGSAQVPGQNQPGFDYVQNGLYNNSGLNGYLPH
NT seq 1980 nt NT seq  +upstreamnt  +downstreamnt
atgtttgaaaaacgattcaaaacctctttactgccgttattcgccggatttttattgctg
tttcatttggttttgtcaggcccggcggctgcaaacgctgaaactgcaaacaaatcgaat
aaggtgaccgcgtcatcggtcaaaaacgggaccatccttcatgcatggaattggtcgttc
aatacgttaacacaaaatatgaaagatattcgtgatgcgggctatgcagccattcagacg
tctccgattaaccaagtaaatgaagggaaccaaggagataaaagcatgaggaactggtac
tggctgtatcagccgacatcgtaccaaatcggcaaccgttacttaggcactgaacaagaa
tttaaggacatgtgtgcagccgcggaaaagtatggcgtaaaagtcattgtcgatgcggtt
atcaatcatactaccagcgattatggcgcgatttctgacgagattaagcgtattccaaac
tggacccatggaaacacacaaattaaaaattggtcggatcgatgggacgtcactcaaaat
tcattgcttgggctgtatgattggaatacacagaatactgaggtgcaggtctatctgaaa
cgtttcttggaaagagcattgaatgacggagcagacggattccgctatgatgccgccaag
catatagagcttccggatgatgggaattacggcagccaattttggccgaatatcacaaat
atatcggcagagttccaatacggagaaatcctgcaagacagcgcgtccagagatactgct
tatgcgaattatatgaatgtgacggcttctaactacgggcattccatcagatccgcttta
aagaaccgtaatctgagtgtgtcgaatatttcccattatgcatctgatgtgtctgcggac
aagttggtcacatgggtggaatcacatgatacgtatgccaatgatgacgaagagtccaca
tggatgagcgatgacgatattcgtttaggatgggcagtgattggttcccgttcaggaagt
acgcctcttttcttttccagacctgagggcggaggaaatggtgtaagatttcccggaaaa
agtcaaataggagatcgcgggagcgccttatttaaagatcaggcgatcactgcggtcaat
caatttcacaatgtaatggccgggcagcccgaggaactctcgaatccgaatgggaacaac
caaatctttatgaatcagcgcggctcaaaaggcgttgtgctggcaaatgcaggatcgtct
tctgtcaccatcaatacttcagcgaaattacctgacggcaggtatgataatagggccggc
gccggttcatttcaagtagcgaacggcaaactgacaggtacgatcaatgccagatccgcg
gctgttctttatcctgatgatattggaaatgcgcctcatgtctttcttgagaattaccaa
acggaggcagtccattctttcaatgatcagctgacggtcaccctgcgtgcaaatgcgaaa
acaacaaaagccgtttaccaaatcaataatgggcagcagacagcatttaaggatggagac
cgactaacgatcgggaaaggagatccaatcggcacgacatacaacatcaaattaaccgga
acgaacggcgagggtgcagcgagaacccaagaatacacgtttgttaaaaaagacccgtcc
caaaccaacatcattggctatcaaaatccggaccattggggccaggtaaatgcttatatt
tacaaacatgatggaggcagggccatagaattaaccggatcgtggccggggaaagccatg
actaagaatgcagatggaatgtacacgctgacgctgcctgagaatgcggatacggccaac
gccaaagtgatttttaacaatggcagcgcccaagtgcccggacagaaccagcccggcttt
gattatgtgcagaatggtttgtataacaactccggtttaaacggttatcttccgcattaa

DBGET integrated database retrieval system