KEGG   Bacillus amyloliquefaciens subsp. plantarum UCMB5033: RBAU_0722Help
Entry
RBAU_0722         CDS       T02795                                 

Gene name
cypD
Definition
putative bifunctional P-450/NADPH-P450 reductase 1 (EC:1.14.14.1 1.6.2.4)
Orthology
K14338  
cytochrome P450 / NADPH-cytochrome P450 reductase [EC:1.14.14.1 1.6.2.4]
Organism
bama  Bacillus amyloliquefaciens subsp. plantarum UCMB5033
Pathway
Fatty acid degradation
Tryptophan metabolism
Aminobenzoate degradation
Microbial metabolism in diverse environments
Class
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:bama00071]
Metabolism; Amino acid metabolism; Tryptophan metabolism [PATH:bama00380]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:bama00627]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
759069..762272
Genome map
AA seq 1067 aa AA seqDB search
MLERVLFMKETGPIPQPKTFGPLGNLPLLDKDKPTMSLIKLANEQGPIFQLHTPAGAIIV
VSGHELVKEVCDEERFDKSIEGALEKVRAFSGDGLFTSWTHEPNWRKAHNILMPTFSQRA
MKDYHSMMTDIAVQLIQKWARLNPDEAVDVPADMTRLTLDTIGLCGFNYRFNSYYRETPH
PFINSMVRALDEAMHQMQRLDVQDKLMIRTKRQFHHDIQAMFSLVDSIIAERRSGGRDEK
DLLARMLNVEDPETGEKLDDENIRFQIITFLIAGHETTSGLLSFAIYFLLKHPRVLEKAY
EEADRVLTDPVPSYKQVLDLTYIRMILQESLRLWPTAPAFSLYAKEDTVIGGKYPITPKD
RISVLIPQLHRDKDAWGDNAEEFYPERFEHPDQVPHHAYKPFGNGQRACIGMQFALHEAT
LVLGMILQHFTFIDHTDYELDIKQTLTIKPGDFHIRVRPRNKEAVAAALPAAEKAAEDVE
KEKRETKGASIIGLDNRPLLILYGSDTGTAEGVARELADTAGMHGVRTETAPLNDRIGKL
PKEGALLIITSSYNGKPPSNAGQFVQWLEEVKPGELEGVRYAVFGCGDHNWAATYQAVPR
LIDEKLAEKGAERFSSRGEGDVSGDFEGKLDEWKKSMWTDAMKAFGLKLNENAEKERSAL
GLQFVSGLGGSPLAQTYEAVYASVAENRELQAPESGRSTRHIEITLPKEAAYHEGDHLGV
LPVNSKEQVSRVLRRFNLNGNDQVLLTASGQSAAHLPLDRPVRLHDLLSSCVELQEAASR
AQIREMAAYTVCPPHKRELEDFLEEGVYQEQILTSRVSMLDLLEKYEACELPFERFLELL
RPLKPRYYSISSSPRKHPGQASITVGVVRGPARSGLGEYRGVASNYLADRGPEDGIVMFV
RTPETRFRLPEDPEKPIIMVGPGTGVAPFRGFLQARAALKKEGKELGEAHLYFGCRNDHD
FIYRDELEAYEKDGIVTLHTAFSRKEGVPKTYVQHLMAKDAGALISILGRGGHLYVCGDG
SKMAPDVEATLQKAYQSVHETDERQAQEWLLDLQTKGIYAKDVWAGI
NT seq 3204 nt NT seq  +upstreamnt  +downstreamnt
gtgttagaaagggtgttattcatgaaggaaacaggtccgattccgcagccgaagacattc
ggcccgctcggcaatcttcctttgcttgataaagacaagcctacaatgtcgctgatcaaa
ctggcaaacgagcaggggcctatttttcagctgcataccccggcgggcgccattatcgtc
gtgtccggccatgaactggtgaaagaggtttgtgatgaagaacggttcgataaaagcatt
gaaggagctttggagaaagtccgggcgttttccggtgacgggctgtttacaagctggacg
catgagcctaactggcgaaaggcgcataatattctgatgccgaccttcagccagcgcgcg
atgaaagattatcattcgatgatgactgatatcgcggtgcagctgattcaaaaatgggct
aggctcaacccggatgaggccgttgatgtgcctgctgatatgacccgcctgacgctcgat
acgatcgggctttgcggctttaactatcggtttaacagctattatagggaaacgcctcat
ccgtttatcaacagcatggtgcgcgcccttgatgaagcgatgcaccaaatgcagcgcctt
gatgttcaggataagcttatgatcaggacgaagcgccaatttcatcatgacattcaggcg
atgttttcgttagtagacagtattatcgcagagcgccggtcaggcggccgggatgaaaag
gatctgctggccagaatgctgaatgtggaagacccggaaacgggcgaaaaacttgatgat
gaaaatatccggtttcaaatcatcacgtttttaattgccggccatgaaacgacaagcggc
ctgctttcctttgccatctactttctgctgaaacatccccgtgttttggaaaaagcctat
gaagaagccgatcgggttttgaccgatcccgttccttcatataaacaagtgctggatctg
acttatatccgaatgattttgcaggagtcattgcgtttatggccgaccgcgcctgcgttc
agcctttatgcgaaagaggatacggtgatcggcgggaaatatccgatcacgccgaaagac
agaatttccgtcttaattccccagcttcaccgtgataaagacgcgtggggagacaatgcg
gaggaattttatccggagcggtttgaacatcctgatcaagtgcctcaccatgcgtataag
ccgttcggaaacggtcagagggcgtgtatcggtatgcagttcgccctgcatgaagcaact
cttgttctggggatgattctgcagcattttacctttatcgatcacaccgattatgagctc
gatattaaacagacactgacgatcaagcccggcgactttcatatccgggtgcggccgaga
aacaaagaagccgttgcggctgctctcccggcggctgaaaaagcggcggaagacgtcgaa
aaagaaaaacgggaaacaaaaggcgcatccattatcgggcttgataaccgaccgcttctg
attctgtacggatcagatacgggaaccgcagaaggcgtggcgcgggagcttgccgatact
gccgggatgcacggcgtccggactgaaacggcgcctttaaatgaccggatcggaaaactg
ccgaaagaaggagctctcttgatcattacgtcctcttataacggaaagcctccgagcaac
gcgggacaattcgttcaatggcttgaagaagtcaaacccggggaactggaaggcgtccga
tatgccgtcttcggctgcggtgatcataactgggcggcgacatatcaggctgtaccgagg
cttattgatgagaagcttgccgaaaaaggggcggaacgcttttcctcccgaggcgagggg
gacgtcagcggcgattttgaaggaaagcttgatgaatggaaaaaaagcatgtggacggac
gccatgaaggcattcggtctcaagctgaatgaaaatgccgaaaaagagcgaagtgcgctg
ggccttcaatttgtcagcgggcttggcgggtctcctttggcacagacgtatgaagcggtt
tacgcatccgttgcggaaaacagggaacttcaggcgccggaaagcggccggagcacaagg
catatcgaaatcactctgccgaaagaggctgcctatcatgaaggggatcatctcggcgtg
ctgccggtaaacagcaaagagcaggtcagccgtgttctccgccggttcaatctgaacggg
aatgatcaagtgctgctgacagccagcggacagagcgcggctcatctcccgctcgatcgg
ccggtcaggctgcatgatcttctgagcagctgtgtcgaattgcaggaagcggcatcaagg
gctcaaatccgggaaatggccgcttatacggtctgcccgccgcacaaacgggaattggaa
gattttcttgaggagggcgtctatcaggagcaaatcttaacatcgcgcgtctcgatgctc
gatctccttgaaaaatatgaagcgtgtgaacttccgtttgagcgatttctggagcttttg
cgcccgttgaagccgcggtattattcgatttcaagttcgccccggaaacatcccgggcag
gcttcaattaccgtcggcgtcgttcgcggccccgcccggagcggtttgggtgagtatcgc
ggagtcgcttcgaattatttagcggaccgcggccctgaggatggtatcgtgatgtttgtc
cgcactccggaaacacgattccggctgccggaagatccggaaaaaccgattattatggtc
ggtcccggcacaggagtcgccccgttccgcggatttctgcaggcccgggcggcgttaaaa
aaagaaggaaaagagctgggggaggctcatctgtatttcggatgcagaaacgatcatgat
tttatttaccgtgacgagcttgaagcttatgaaaaagacggaatcgtgacgcttcatacg
gctttctcccgcaaagaaggcgtaccgaaaacgtatgtgcagcacttaatggcgaaagac
gccggcgctttaatttccatcctcggccggggagggcacctctacgtatgcggcgacggc
agcaaaatggcgcccgatgtagaggcaacgctgcaaaaagcgtatcagtcggtccacgaa
acagacgaacggcaagcgcaagaatggcttttggacctccagacaaaaggcatttacgca
aaagatgtttgggcggggatttga

DBGET integrated database retrieval system