KEGG   Bacillus amyloliquefaciens subsp. plantarum UCMB5033: RBAU_0722Help
Entry
RBAU_0722         CDS       T02795                                 

Gene name
cypD
Definition
putative bifunctional P-450/NADPH-P450 reductase 1 (EC:1.14.14.1 1.6.2.4)
Orthology
K14338  
cytochrome P450 / NADPH-cytochrome P450 reductase [EC:1.14.14.1 1.6.2.4]
Organism
bama  Bacillus amyloliquefaciens subsp. plantarum UCMB5033
Pathway
Fatty acid degradation
Tryptophan metabolism
Aminobenzoate degradation
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bama00001]
 Metabolism
  Lipid metabolism
   00071 Fatty acid degradation
    RBAU_0722 (cypD)
  Amino acid metabolism
   00380 Tryptophan metabolism
    RBAU_0722 (cypD)
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    RBAU_0722 (cypD)
Enzymes [BR:bama01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     RBAU_0722 (cypD)
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     RBAU_0722 (cypD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
759069..762272
Genome map
AA seq 1067 aa AA seqDB search
MLERVLFMKETGPIPQPKTFGPLGNLPLLDKDKPTMSLIKLANEQGPIFQLHTPAGAIIV
VSGHELVKEVCDEERFDKSIEGALEKVRAFSGDGLFTSWTHEPNWRKAHNILMPTFSQRA
MKDYHSMMTDIAVQLIQKWARLNPDEAVDVPADMTRLTLDTIGLCGFNYRFNSYYRETPH
PFINSMVRALDEAMHQMQRLDVQDKLMIRTKRQFHHDIQAMFSLVDSIIAERRSGGRDEK
DLLARMLNVEDPETGEKLDDENIRFQIITFLIAGHETTSGLLSFAIYFLLKHPRVLEKAY
EEADRVLTDPVPSYKQVLDLTYIRMILQESLRLWPTAPAFSLYAKEDTVIGGKYPITPKD
RISVLIPQLHRDKDAWGDNAEEFYPERFEHPDQVPHHAYKPFGNGQRACIGMQFALHEAT
LVLGMILQHFTFIDHTDYELDIKQTLTIKPGDFHIRVRPRNKEAVAAALPAAEKAAEDVE
KEKRETKGASIIGLDNRPLLILYGSDTGTAEGVARELADTAGMHGVRTETAPLNDRIGKL
PKEGALLIITSSYNGKPPSNAGQFVQWLEEVKPGELEGVRYAVFGCGDHNWAATYQAVPR
LIDEKLAEKGAERFSSRGEGDVSGDFEGKLDEWKKSMWTDAMKAFGLKLNENAEKERSAL
GLQFVSGLGGSPLAQTYEAVYASVAENRELQAPESGRSTRHIEITLPKEAAYHEGDHLGV
LPVNSKEQVSRVLRRFNLNGNDQVLLTASGQSAAHLPLDRPVRLHDLLSSCVELQEAASR
AQIREMAAYTVCPPHKRELEDFLEEGVYQEQILTSRVSMLDLLEKYEACELPFERFLELL
RPLKPRYYSISSSPRKHPGQASITVGVVRGPARSGLGEYRGVASNYLADRGPEDGIVMFV
RTPETRFRLPEDPEKPIIMVGPGTGVAPFRGFLQARAALKKEGKELGEAHLYFGCRNDHD
FIYRDELEAYEKDGIVTLHTAFSRKEGVPKTYVQHLMAKDAGALISILGRGGHLYVCGDG
SKMAPDVEATLQKAYQSVHETDERQAQEWLLDLQTKGIYAKDVWAGI
NT seq 3204 nt NT seq  +upstreamnt  +downstreamnt
gtgttagaaagggtgttattcatgaaggaaacaggtccgattccgcagccgaagacattc
ggcccgctcggcaatcttcctttgcttgataaagacaagcctacaatgtcgctgatcaaa
ctggcaaacgagcaggggcctatttttcagctgcataccccggcgggcgccattatcgtc
gtgtccggccatgaactggtgaaagaggtttgtgatgaagaacggttcgataaaagcatt
gaaggagctttggagaaagtccgggcgttttccggtgacgggctgtttacaagctggacg
catgagcctaactggcgaaaggcgcataatattctgatgccgaccttcagccagcgcgcg
atgaaagattatcattcgatgatgactgatatcgcggtgcagctgattcaaaaatgggct
aggctcaacccggatgaggccgttgatgtgcctgctgatatgacccgcctgacgctcgat
acgatcgggctttgcggctttaactatcggtttaacagctattatagggaaacgcctcat
ccgtttatcaacagcatggtgcgcgcccttgatgaagcgatgcaccaaatgcagcgcctt
gatgttcaggataagcttatgatcaggacgaagcgccaatttcatcatgacattcaggcg
atgttttcgttagtagacagtattatcgcagagcgccggtcaggcggccgggatgaaaag
gatctgctggccagaatgctgaatgtggaagacccggaaacgggcgaaaaacttgatgat
gaaaatatccggtttcaaatcatcacgtttttaattgccggccatgaaacgacaagcggc
ctgctttcctttgccatctactttctgctgaaacatccccgtgttttggaaaaagcctat
gaagaagccgatcgggttttgaccgatcccgttccttcatataaacaagtgctggatctg
acttatatccgaatgattttgcaggagtcattgcgtttatggccgaccgcgcctgcgttc
agcctttatgcgaaagaggatacggtgatcggcgggaaatatccgatcacgccgaaagac
agaatttccgtcttaattccccagcttcaccgtgataaagacgcgtggggagacaatgcg
gaggaattttatccggagcggtttgaacatcctgatcaagtgcctcaccatgcgtataag
ccgttcggaaacggtcagagggcgtgtatcggtatgcagttcgccctgcatgaagcaact
cttgttctggggatgattctgcagcattttacctttatcgatcacaccgattatgagctc
gatattaaacagacactgacgatcaagcccggcgactttcatatccgggtgcggccgaga
aacaaagaagccgttgcggctgctctcccggcggctgaaaaagcggcggaagacgtcgaa
aaagaaaaacgggaaacaaaaggcgcatccattatcgggcttgataaccgaccgcttctg
attctgtacggatcagatacgggaaccgcagaaggcgtggcgcgggagcttgccgatact
gccgggatgcacggcgtccggactgaaacggcgcctttaaatgaccggatcggaaaactg
ccgaaagaaggagctctcttgatcattacgtcctcttataacggaaagcctccgagcaac
gcgggacaattcgttcaatggcttgaagaagtcaaacccggggaactggaaggcgtccga
tatgccgtcttcggctgcggtgatcataactgggcggcgacatatcaggctgtaccgagg
cttattgatgagaagcttgccgaaaaaggggcggaacgcttttcctcccgaggcgagggg
gacgtcagcggcgattttgaaggaaagcttgatgaatggaaaaaaagcatgtggacggac
gccatgaaggcattcggtctcaagctgaatgaaaatgccgaaaaagagcgaagtgcgctg
ggccttcaatttgtcagcgggcttggcgggtctcctttggcacagacgtatgaagcggtt
tacgcatccgttgcggaaaacagggaacttcaggcgccggaaagcggccggagcacaagg
catatcgaaatcactctgccgaaagaggctgcctatcatgaaggggatcatctcggcgtg
ctgccggtaaacagcaaagagcaggtcagccgtgttctccgccggttcaatctgaacggg
aatgatcaagtgctgctgacagccagcggacagagcgcggctcatctcccgctcgatcgg
ccggtcaggctgcatgatcttctgagcagctgtgtcgaattgcaggaagcggcatcaagg
gctcaaatccgggaaatggccgcttatacggtctgcccgccgcacaaacgggaattggaa
gattttcttgaggagggcgtctatcaggagcaaatcttaacatcgcgcgtctcgatgctc
gatctccttgaaaaatatgaagcgtgtgaacttccgtttgagcgatttctggagcttttg
cgcccgttgaagccgcggtattattcgatttcaagttcgccccggaaacatcccgggcag
gcttcaattaccgtcggcgtcgttcgcggccccgcccggagcggtttgggtgagtatcgc
ggagtcgcttcgaattatttagcggaccgcggccctgaggatggtatcgtgatgtttgtc
cgcactccggaaacacgattccggctgccggaagatccggaaaaaccgattattatggtc
ggtcccggcacaggagtcgccccgttccgcggatttctgcaggcccgggcggcgttaaaa
aaagaaggaaaagagctgggggaggctcatctgtatttcggatgcagaaacgatcatgat
tttatttaccgtgacgagcttgaagcttatgaaaaagacggaatcgtgacgcttcatacg
gctttctcccgcaaagaaggcgtaccgaaaacgtatgtgcagcacttaatggcgaaagac
gccggcgctttaatttccatcctcggccggggagggcacctctacgtatgcggcgacggc
agcaaaatggcgcccgatgtagaggcaacgctgcaaaaagcgtatcagtcggtccacgaa
acagacgaacggcaagcgcaagaatggcttttggacctccagacaaaaggcatttacgca
aaagatgtttgggcggggatttga

DBGET integrated database retrieval system