KEGG   Bacillus amyloliquefaciens subsp. plantarum UCMB5033: RBAU_0999Help
Entry
RBAU_0999         CDS       T02795                                 

Gene name
hemY
Definition
protoporphyrinogen IX and coproporphyrinogen III oxidase (EC:1.3.3.4)
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
bama  Bacillus amyloliquefaciens subsp. plantarum UCMB5033
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bama00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    RBAU_0999 (hemY)
Enzymes [BR:bama01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     RBAU_0999 (hemY)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1043826..1045259
Genome map
AA seq 477 aa AA seqDB search
MSGDKKHLVIIGGGITGLAAAFYMEKEIKEKQLPLEVTLIEAGPRAGGKIQTAHKDGYII
ERGPDSFLERKKSAPQLVKDLGLEHLLVNNATGQSYVLVNETLHPMPKGAVMGIPTKIAP
FISTGLFSVPGKARAALDFVLPASKPKEDQSLGEFFRRRVGDEVVENLIEPLLSGIYAGD
IDKLSLMSTFPQFYQTEQKHRSLILGMKKSRPQPSGQQLTAKKQGQFLTLTTGLQTLVEE
LEKQLTLTKVMKGTKVTHIGREEKGYSVTLDNGKVLYSEGCIVTAPHKAAAKMLSDLPAV
SCLKDMHSTSVANVALGFPEGAVKMEHEGTGFVISRNSDFSITACTWTNKKWPHAAPEGK
TLLRAYVGKAGDESIVDLSDNEIIKIVMEDLKKVMKINGEPEMTCVTRWNESMPQYHVGH
KERIKEFRDALKASYPGVYATGASFEGVGIPDCIDQGKAAVYDSLAYLFETYQPPLS
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgagtggcgataaaaaacatctggtcatcatcggcggcggcataacgggattagccgcc
gccttctacatggaaaaagaaatcaaagaaaaacagctgccgcttgaggtcactctgatt
gaagcgggcccgagagcgggcggcaaaattcagacggcgcataaagacggctacatcatt
gagcgggggccggattcttttttggaaaggaaaaaaagcgcgccgcagctcgtcaaggat
ttggggcttgagcatctgctcgtcaacaatgcgaccggccagtcttacgtgctcgtcaac
gagacgctccatccgatgccgaagggcgctgtgatgggcatcccgaccaaaatcgctccg
ttcatctccaccggtttattttctgttcccggaaaggcgcgggcggcgcttgactttgtc
ctgcctgcgagcaaaccgaaggaagatcagtctctgggtgaatttttccgcagacgcgtc
ggtgacgaagtcgttgagaatttaatagaaccgctattatcagggatttatgccggagat
attgataagctgagcctcatgtccacgtttccgcaattctatcagactgagcaaaagcac
agaagcctgattctcggtatgaaaaaatcacgtccgcagccttcgggacagcagctgacg
gccaaaaagcagggccagtttttaacgctgacgacagggcttcaaacgttggtggaggag
ctggaaaagcagcttacgctgacaaaagtgatgaaaggcacgaaagtcacccatatcggc
cgcgaggagaaaggatattccgtgacgcttgataacggcaaagtgctctattcggaagga
tgcatagtgacagccccgcataaagccgcggcgaaaatgctttctgatctgccggcggtt
tcatgtcttaaagacatgcattctacgtccgttgccaacgtcgccttaggttttcctgag
ggagccgtcaagatggagcatgaaggtacgggattcgttatctcaagaaacagtgacttc
tccatcacggcctgcacatggacgaataaaaaatggccgcacgcggcgccggagggcaaa
acgcttctcagggcgtacgtcggaaaggccggagatgaatccatcgtagatctttcagat
aacgagatcattaaaatcgtaatggaagatttgaaaaaagtaatgaaaataaatggcgaa
ccggaaatgacctgtgtgacccgctggaacgaaagcatgccgcaataccatgtcggccat
aaggagcgcatcaaagagttcagagatgcgctgaaagcttcctatccgggcgtatacgcg
acgggcgcgtctttcgaaggggtgggcatcccggactgtatcgaccagggaaaagccgcc
gtatacgattcactggcttatttatttgaaacgtaccagcctccgttatcgtaa

DBGET integrated database retrieval system