KEGG   Bacillus methylotrophicus UCMB5033: RBAU_1445Help
Entry
RBAU_1445         CDS       T02795                                 

Gene name
glsB
Definition
(GenBank) glutaminase (EC:3.5.1.2)
  KO
K01425  
glutaminase [EC:3.5.1.2]
Organism
bama  Bacillus methylotrophicus UCMB5033
Pathway
Arginine biosynthesis
Alanine, aspartate and glutamate metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bama00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    RBAU_1445 (glsB)
   00220 Arginine biosynthesis
    RBAU_1445 (glsB)
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    RBAU_1445 (glsB)
Enzymes [BR:bama01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     RBAU_1445 (glsB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1507549..1508478
Genome map
AA seq 309 aa AA seqDB search
MVCRHYQELDALVQEAKKRTEEGKVADYIPALAESEQDSLSVTIYHAENTCLTAGDADRT
FTLQSISKVLSLALVLMDYGKEKVFSCVGQEPTGDPFNSMIKLETVNPGKPLNPMINAGA
LVVTGFIKGHSPKDRLDYLLGFIRRLANNQDITYCRHVAESEFSSSMINRAMCYYMKQYD
IFKGDVEEVMDLYTKQCAIKMSSLDLAKIGCVFALDGKHPETGEQVIKKDVARICKTFMV
TCGMYNASGEFAIKVGIPAKSGVSGGIMGISPYNFGIGIFGPALDEKGNSIAGVKLLEIM
SEKYRLSIF
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atggtatgccggcattaccaagagctggacgcattagttcaggaagcgaaaaaaaggacc
gaagaaggcaaagtggcagactatattccggctctggctgaatctgaacaagacagcctt
tcggtcacgatttatcatgcggaaaatacatgtctgacggcaggagacgccgaccggaca
tttacgctgcagagcatttcgaaagtgctttctctggcgctcgtactgatggattacgga
aaggaaaaggtgttcagctgcgtgggtcaggagccgaccggcgacccgtttaattccatg
attaagcttgaaacagtgaatccgggcaagcctttaaatccgatgattaatgcgggcgct
ctcgtcgtaacgggtttcattaaagggcattcgccgaaagaccgcctggattacctgctc
ggattcatcagaagacttgcgaataatcaggacattacatattgcagacatgtcgcggaa
tcggaattcagttcatccatgattaatcgggccatgtgttattacatgaagcagtatgac
atttttaaaggcgatgttgaagaggtcatggatttgtatacaaaacagtgcgcgattaag
atgagcagtctggacttagccaaaatcggctgcgtattcgcccttgacggcaagcatccg
gaaaccggggagcaggtcattaaaaaagatgtggcgagaatctgcaagacgtttatggtg
acatgcggcatgtacaatgcgagcggggaattcgcgatcaaggtcggcattcccgctaaa
agcggcgtttcgggaggaatcatgggcatttcgccgtacaacttcggaatcggtatattc
ggcccggcgcttgatgaaaaaggcaacagcatcgcgggtgtgaagcttttggaaatcatg
tctgagaaatacaggctgagtattttttga

DBGET integrated database retrieval system