KEGG   Bacillus amyloliquefaciens subsp. plantarum UCMB5033: RBAU_1905Help
Entry
RBAU_1905         CDS       T02795                                 

Definition
Glucan endo-1,6-beta-glucosidase (EC:3.2.1.75)
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
bama  Bacillus amyloliquefaciens subsp. plantarum UCMB5033
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bama00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    RBAU_1905
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    RBAU_1905
Enzymes [BR:bama01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     RBAU_1905
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2079994..2081472)
Genome map
AA seq 492 aa AA seqDB search
MFFKKGLHMTLVFLMFFFFISSSMETEVYAADRKASDKNKVRVWFSSEKDPASRTWYDGP
LEVKYALDEQTPLTLTKKKASDSSTVYIDPSRRYQSVLGVGSSLEESTIHNLSKMTPAKR
KEVLKKLVDPKDGIGMDVMRITIGTSDFTAQEFYTYDDMPEGQTDPKLRHFSIQKDIDLH
ITATIKEALAINPELKIIASPWSPPAWMKTNENLKRGKLKDKYIGTLAVYFRKFIEAYEK
QGIPIYALTLQNEPLLEIDYPSMYMPPSQQRKLALALKKEMKQHVIDTKIWIYDHNASGA
WNYIPPILDDKKGNRAADGIAFHDYDGDLSVMSEIGKRYPDKSIHLTERSVWGTAGADRI
AQYFRNGASSYNAWVTMLDSQIKTHHWIGTPDPTLFIQDAKNPDRYWNIPIFHMTGNFSK
FIDRGAKRIESNYGSKNTVSNVSFLNPDQSIVTVVINQTSSEQKFHVVSENRQFEAVIPA
KTVATYKWKRKK
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atgttttttaaaaaaggtctgcacatgacgctggtttttcttatgtttttctttttcata
tcaagcagcatggaaaccgaagtgtatgcggctgatcggaaggcttcagacaaaaacaaa
gtaagggtgtggttcagttctgaaaaagatccggcttcccgtacgtggtatgacgggccg
ctagaagtgaaatacgccttagacgaacaaacaccgcttacattgacaaaaaagaaggct
tctgactcctccactgtgtatattgatccgtcgcgccgctatcaaagtgtgttaggcgta
ggatcgtccctggaagaatccacaatccataatttatcaaaaatgacacccgcaaaaaga
aaagaagtgctgaaaaaactggttgatcccaaagatggtatcggaatggacgttatgcgc
ataacgatcgggacatctgattttacggcacaggagttttatacgtatgacgatatgcct
gaaggccaaacagatcctaagctccgtcatttctcgatccaaaaggatattgatttacac
attacagcaaccatcaaggaagcgctggcgataaatccggaactgaaaatcattgcctca
ccgtggagcccgccggcttggatgaaaacgaatgaaaacctcaagcggggaaagctgaaa
gataaatatatcggcacactggccgtttacttccgcaaatttattgaggcgtacgaaaag
caaggaattccgatttatgcgctgacccttcaaaatgaacctttgctggaaatcgactat
ccgagcatgtatatgccgccgtctcagcagcgtaaactggcactggccttaaaaaaagaa
atgaaacaacacgtaattgacacgaaaatttggatttatgatcacaatgcgagcggggcg
tggaactatattccgccgattttagatgataaaaaaggaaaccgggcggcagacggcatc
gcttttcacgattatgacggtgacctttccgtcatgtcggaaatcggaaagagatatcct
gataaatctattcacttaacggagcggtctgtctgggggacggcaggggcggaccggatc
gcgcagtatttccgcaatggcgcgtcgagctacaatgcgtgggtgacgatgctcgacagt
caaatcaagacgcatcattggataggcaccccagacccgacgctgtttattcaggatgct
aaaaaccctgaccgctattggaatatcccgatctttcatatgacaggcaacttttcaaaa
tttatcgaccggggagcaaagcggatagaaagtaattacggctccaaaaacacagtctcg
aatgtatcgttccttaatcctgatcaatccattgtgacagtcgtaatcaaccagacatct
tcagaacaaaaattccatgtcgtttcagaaaatcggcagtttgaagccgtcatcccggct
aaaaccgtggctacctacaaatggaagcgaaaaaagtaa

DBGET integrated database retrieval system