KEGG   Bacillus amyloliquefaciens subsp. plantarum UCMB5033: RBAU_2563Help
Entry
RBAU_2563         CDS       T02795                                 

Gene name
cypB
Definition
cytochrome P450 CYP102A3 (EC:1.14.14.1)
Orthology
K14338  
cytochrome P450 / NADPH-cytochrome P450 reductase [EC:1.14.14.1 1.6.2.4]
Organism
bama  Bacillus amyloliquefaciens subsp. plantarum UCMB5033
Pathway
Fatty acid degradation
Tryptophan metabolism
Aminobenzoate degradation
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bama00001]
 Metabolism
  Lipid metabolism
   00071 Fatty acid degradation
    RBAU_2563 (cypB)
  Amino acid metabolism
   00380 Tryptophan metabolism
    RBAU_2563 (cypB)
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    RBAU_2563 (cypB)
Enzymes [BR:bama01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     RBAU_2563 (cypB)
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     RBAU_2563 (cypB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2701581..2704742)
Genome map
AA seq 1053 aa AA seqDB search
MKQLSAIPQPKTYGPLKNLPHLEKEKLSQSLWKIAEEYGPIFRFEFPSSVGVFVSGRELA
AEVCDEKRFDKNLSKALLKVREFGGDGLFTSWTHEKNWQKAHRILLPSFSQKAMKGYHSM
MLDIAMQLVQKWSRLNPNEEIDVAEDMTRLTLDTIGLCGFHYRFNSFYRDTQHPFITSML
RALQEAMRQSQRHSLQDKLMIKTRHQFQQDIEEMNSLVDRIIAERRENPDENLSDLLALM
LEAKDPVTGERLDDENIRYQIITFLIAGHETTSGLLSFAIYCLLKNKDKLKKAVQEAERV
LTGETPEYKQIQQLTYIRMVLNETLRLYPTAPAFSLYAKEDTVLGGKYPIAKGQPVTILT
PQLHRDKSAWGEDAESFRPERFSDPAAIPADAYKPFGNGQRACIGMQFALQEATMVLGLV
LKHFELIDHTDYELTIKEALTIKPGDFKIRVKNKDVSNHQPVQNHKAEGSGHKEETKEIP
SHGTPLLILYGSNLGTAEGIAEELADIGRSKGFSTETGPLDDYAGKLPVKGAVVIVTASY
NGAPPDNAAGFVKWMETLEDQELKGVSYAVFGCGDRNWAATYQRIPRLIDKVLEEKGAKR
LTSIGEGDNADDFEYSQEAWEDSFWKDIMKAFHIEAAPKQTNKSQLSIEYVSEAAETPIA
KTYKAFEAEVITNKELHTESSKRSVRHIELRLPETETYQEGDHLGVLPQNSGELISRVIR
RFGLDPNQHFKIKGRQLPHLPMDRPVNAPELLASYVELQEPATRAQLRELAAHTVCPPHQ
KELEHLYSDDAAYKENVLKKRMTMLDLLEDYPACELPFERFLELLPSLKARYYSISSSPK
ATSGELSITVGVVTAPAWSGRGEYRGVASNYLAGLQKGDSAVCFIRSPQSGFALPENPKT
PLIMVGAGTGIAPFRGFIQARAAEKMSGNSLGEAHLYFGCRHPEEDDLYKDEFDHAEKNG
LVTVHRAYSRLDQDCKVYVQDVLLREAAQIIALLDQGGHLYICGDGSKMAPAVENVLLQA
YEKVHNTDSKVSLEWLEQLQAEGRYAKDVWAGM
NT seq 3162 nt NT seq  +upstreamnt  +downstreamnt
atgaaacagctaagcgctataccgcagccgaaaacatacgggcctctgaaaaatctccct
cacttggaaaaagaaaaactgtcacaatcgctttggaaaattgccgaagaatacggcccg
atctttcgttttgaatttccgagctctgtcggggtcttcgtatcaggccgcgagctcgcg
gcagaagtctgcgatgaaaagcgatttgacaaaaatctcagcaaagctttgctgaaggtc
cgtgagtttggcggtgacggactatttacgagctggactcacgaaaagaattggcagaaa
gcgcatcggattttattgccgagcttcagccagaaggcgatgaaaggctatcattcaatg
atgctggatattgccatgcagctcgtgcagaagtggagcagattaaatccgaatgaagaa
attgatgttgccgaagatatgacgcgcctgacgctggatacaatcggcctgtgcggattt
cattaccgctttaacagcttttaccgcgacacacagcatccttttatcacaagtatgctt
cgtgcgctgcaggaggcaatgcgccaatcacaaagacacagcctgcaggacaagctgatg
atcaaaacgagacatcagttccagcaggatattgaagagatgaattcgcttgtagaccgg
atcatcgctgaacggagggaaaatccggatgagaatctgtctgaccttttagcattgatg
cttgaagcgaaagaccccgtaacgggggaaaggctggatgatgaaaatatccgttatcaa
atcattacctttttgatcgctgggcatgaaaccacaagcgggctgctttcttttgcgata
tactgcctgctgaaaaataaagataaattgaaaaaagccgttcaggaagccgagcgggtg
ctgacgggagagacccctgaatataagcagattcagcagctgacatatatccgcatggtg
ctaaacgagactttgcggctgtatccgactgccccggcattttctctgtacgcgaaagaa
gatacggttctcggcgggaaatatccgattgcgaagggacagccggtgacgattctgact
ccgcagctgcaccgggataaaagcgcatggggagaagatgccgagtcattccgtccggaa
aggttcagtgatcccgcggcaatcccggcagatgcgtataagccgttcggaaacggacag
cgcgcatgcatcgggatgcagtttgccctgcaggaagcgacaatggtgctcggccttgtc
ctgaaacattttgaactgattgatcatactgattatgagcttacgattaaagaagctcta
accattaagcccggtgattttaaaatccgtgtgaaaaacaaggacgtgtccaatcatcag
cccgtacaaaaccataaagctgaaggcagcggtcacaaagaagaaacgaaagaaatcccg
tcccacggaacgccgcttctcattctttacggttcaaatttgggaactgcggaaggaatc
gcggaagagctggctgatatcggaagaagcaaaggattttcaactgaaaccggcccgctc
gatgattatgccgggaaactgcctgtaaaaggcgcggtcgttattgttacggcttcttat
aacggggcgccgcctgataatgcagcgggttttgtgaaatggatggaaacccttgaagat
caggaattaaagggtgtttcttacgccgtcttcggctgcggagaccgcaactgggccgcc
acttaccaaaggatcccccgcctgatagacaaagtgcttgaagaaaaaggggcaaaacgg
ctgacctctatcggggagggcgacaatgccgatgattttgagtacagtcaggaagcctgg
gaagactcattctggaaggacatcatgaaggcttttcatatagaggccgctccaaaacag
acaaacaaatcacagttatcaatcgaatacgtaagtgaagcagccgagacgccgattgcc
aaaacgtacaaagcatttgaggcggaggtcatcacgaacaaagagcttcataccgaaagc
agcaagcgctcagtccggcatattgagctgcgtctccccgaaacagaaacgtatcaggaa
ggagatcatctcggggtgcttccgcaaaacagcggggaactgatcagccgtgtcattcgc
cgattcggtcttgatccgaaccagcactttaagatcaagggccggcagctgcctcatctg
ccgatggaccggccggttaatgcgccggagcttttggcgtcctatgtagagctgcaggag
ccggcaacgagagcccagcttcgcgaacttgccgcacataccgtgtgcccgccgcaccaa
aaagaattggagcatctttattctgatgatgcggcatataaagaaaacgtgctgaaaaaa
cgaatgaccatgctggacctgctggaagattatcctgcatgtgaactgccgtttgagcgc
tttttagaacttctgccgtccttaaaggcgcgctattattcaatctcaagctcaccgaag
gcaaccagcggggagctcagtatcacggtcggcgttgtgacggctccggcatggagcggc
cgtggggaataccggggcgtggcttcgaactatttagccggattacaaaaaggcgattct
gccgtctgtttcatccgctcgccgcagtcgggtttcgcattgcctgaaaatccgaaaacg
cctctcattatggtcggagcaggcacaggaattgcgccgttcaggggatttatccaggcg
cgggctgccgaaaaaatgtccggtaacagcctgggtgaagctcatttatacttcggctgc
cggcatcctgaagaagacgatctgtacaaagatgaattcgaccatgcggagaaaaacggc
cttgtcaccgtgcatcgggcgtattccaggttagatcaggactgtaaagtatatgtacag
gatgttctgcttcgcgaggctgcacaaattattgcccttcttgaccaaggcggccatctc
tatatatgcggcgacggaagcaaaatggctccggctgtcgaaaatgtactgcttcaggcg
tatgaaaaggtgcataacaccgattcaaaagtttccttggagtggcttgaacagctgcag
gcggaaggaagatatgcgaaagatgtttgggcaggtatgtaa

DBGET integrated database retrieval system