KEGG   Bacillus amyloliquefaciens subsp. plantarum UCMB5033: RBAU_3513Help
Entry
RBAU_3513         CDS       T02795                                 

Gene name
xynA
Definition
endo-1,4-beta-xylanase A (EC:3.2.1.8)
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
bama  Bacillus amyloliquefaciens subsp. plantarum UCMB5033
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3648836..3649477
Genome map
AA seq 213 aa AA seqDB search
MFKFKKKFLVGLTAAFMSISMFSATASAAGTDYWQNWTDGGGTVNAVNGSGGNYSVNWSN
TGNFVVGKGWTTGSPFRTINYNAGVWAPNGNGYLTLYGWTRAPLIEYYVVDSWGTYRPTG
TYKGTVKSDGGTYDIYTTTRYNAPSIDGDNTTFTQYWSVRQSKRPTGSNAAITFSNHVNA
WKSHGMNLGSNWAYQVLATEGYKSSGSSNVTVW
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgtttaagtttaaaaagaaattcttagttggattaacggcagctttcatgagtatcagc
atgttttcggcaaccgcctctgcagctggtacagattactggcaaaattggactgatggg
ggcggaacagtaaacgcagtcaatggatctggcgggaattacagtgttaattggtctaat
accggaaatttcgttgttggtaaaggctggactacaggctcgccatttagaacaataaac
tataatgccggagtctgggcgccgaatggcaatggatatttgactttatatggctggacg
agagcacctctcatcgaatattatgtagtggattcatggggtacttacagacctaccgga
acgtataaaggtactgtaaagagtgatggaggtacatatgacatatatacaacaacacgt
tataacgcaccttccattgatggcgataacactacttttacgcagtactggagtgttcgc
cagtcgaagagaccgaccggaagcaacgctgcaatcactttcagcaatcatgttaacgca
tggaagagccatggaatgaatctgggcagtaattgggcttatcaagtcttagcgacagaa
ggatataaaagcagcggaagttctaatgtaacagtgtggtaa

DBGET integrated database retrieval system