KEGG   Bacillus amyloliquefaciens subsp. plantarum NAU-B3: BAPNAU_0269Help
Entry
BAPNAU_0269       CDS       T02859                                 

Gene name
amyE
Definition
alpha-amylase precursor (EC:3.2.1.1)
Orthology
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
bamb  Bacillus amyloliquefaciens subsp. plantarum NAU-B3
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:bamb00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
296790..298769
Genome map
AA seq 659 aa AA seqDB search
MFKKRFKTSLLPLFAGFLLLFHLVLSGPAAANAETAHKSNEVTDSSVKNGTILHAWNWSF
NTLTENMKEIRDAGYAAIQTSPINQVKEGNQGDKSMSNWYWLYQPTSYQIGNRYLGTEQE
FKDMCAAAEKYGVKVIVDAVVNHTTSDYGAISDEIKRIPNWTHGNTQIKNWSDRWDITQN
ALLGLYDWNTQNTEVQAYLKGFLERALNDGADGFRYDAAKHIELPDDGNYGSQFWPNIAN
TSAEFQYGEILQDSASRDTAYANYMNVTASNYGHSIRSALKNRNLSVSNISHYASDVSAD
KLVTWVESHDTYANDDEESTWMSDDDIRLGWAVIGSRSGSTPLFFSRPEGGGNGVRFPGK
SQIGDRGSALFKDQAITAVNQFHNEMAGQPEELTNPNGNNQIFMNQRGSKGVVLANAGSS
SVTINTSTKLPDGRYDNRAGAGSFQVANGKLTGTINARSAAVLYPDDIGNAPHVFLENYQ
TEAVHSFNDQLTVTLRANAKTTKAVYQINNGQETAFKDGDRLTIGKEDPIGTTYNVKLTG
TNGEGASRTQEYTFVKKDPSQTNIIGYQNPDHWGNVNAYIYKHDGGGAIELTGSWPGKAM
TKNADGIYTLTLPANADTANAKVIFNNGSAQVPGQNHPGFDYVQNGLYNNSGLNGYLPH
NT seq 1980 nt NT seq  +upstreamnt  +downstreamnt
atgtttaaaaaacgattcaaaacctctttactgccgttattcgccggatttttattgctg
tttcatttggttttgtcaggcccggcggctgcaaacgctgaaactgcacacaaatcgaat
gaggtgaccgattcatcggtcaaaaacgggaccatccttcatgcatggaattggtcattc
aatacgttaacagaaaatatgaaagagattcgtgatgcgggttatgcagctattcagacg
tctccgattaaccaagtaaaggaagggaaccaaggagataaaagcatgtcgaactggtac
tggctctatcagccgacatcgtaccaaatcggcaaccgttacttaggcactgaacaagaa
tttaaggacatgtgtgcagccgcggaaaagtatggcgtaaaagtcattgtcgatgcggtt
gtcaatcataccaccagcgattatggcgcgatttctgatgagattaagcgtattccaaac
tggacccatggaaacacacaaattaaaaattggtcggaccgatgggacatcactcaaaat
gcattgcttgggctgtatgattggaatactcagaatactgaggtgcaagcctacctgaaa
ggtttcttggaaagagcattgaatgacggagcagacgggttccgctatgatgccgccaag
catatagagcttccggatgatgggaattacggcagccaattttggccgaatatcgcaaat
acatcggcggagttccaatacggagaaatcctgcaagacagcgcgtccagagatactgct
tatgcgaattatatgaatgtgacggcttctaactatgggcattccatcagatccgcttta
aagaatcgtaatctgagtgtgtcgaatatctcccattatgcatctgatgtgtctgcggac
aagttagtcacatgggtggaatcacatgatacgtatgccaatgatgatgaagagtccaca
tggatgagtgatgacgatattcgtttaggctgggcagtgattggttcccgctcaggaagc
acgcctcttttcttttccagacctgagggcggaggaaatggtgtaagatttcccggaaaa
agtcaaataggagatcgcgggagcgccttatttaaagaccaggcgatcactgcggtcaat
caatttcacaatgaaatggccgggcagcctgaggaactcacaaatccgaatggcaacaat
caaatatttatgaatcagcgcggctcaaaaggcgttgtgctggcaaatgcaggatcgtct
tctgtcaccatcaatacttcaacgaaattacctgacggcaggtatgataatagggccggc
gccggttcatttcaagtagcgaacggcaaactgacaggtacgatcaatgccagatccgcg
gctgttctttatcctgatgatattggaaatgcgcctcatgtctttcttgagaattaccaa
acagaggcagtccattctttcaatgatcagctgacggtcaccctgcgtgcaaatgcgaaa
acaacaaaagccgtttaccaaatcaataatgggcaggagacagcatttaaggatggagac
cgattaacgatcgggaaagaagatccaatcggcacgacatacaacgtcaagttaaccgga
acgaacggcgagggtgcatcgagaacccaagaatacacgtttgtcaaaaaagacccgtcc
caaaccaacatcattggctatcaaaatccggatcattggggcaatgtaaatgcttatatc
tataaacatgatggaggcggggccatagaattaaccggatcgtggccggggaaagccatg
actaagaatgcagatggaatttacacgctgacgctgcctgcgaatgcggatacggccaac
gctaaagtgatttttaacaatggcagcgcccaagtgcccggacagaaccatcccggcttt
gattatgtgcagaatggtttgtataacaactctggtttgaatggttatcttccgcattaa

DBGET integrated database retrieval system