KEGG   Bacillus amyloliquefaciens subsp. plantarum NAU-B3: BAPNAU_0670Help
Entry
BAPNAU_0670       CDS       T02859                                 

Gene name
YetO
Definition
NADPH-ferrihemoprotein reductase (EC:1.14.14.1)
Orthology
K14338  
cytochrome P450 / NADPH-cytochrome P450 reductase [EC:1.14.14.1 1.6.2.4]
Organism
bamb  Bacillus amyloliquefaciens subsp. plantarum NAU-B3
Pathway
Fatty acid degradation
Tryptophan metabolism
Aminobenzoate degradation
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bamb00001]
 Metabolism
  Lipid metabolism
   00071 Fatty acid degradation
    BAPNAU_0670 (YetO)
  Amino acid metabolism
   00380 Tryptophan metabolism
    BAPNAU_0670 (YetO)
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    BAPNAU_0670 (YetO)
Enzymes [BR:bamb01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     BAPNAU_0670 (YetO)
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     BAPNAU_0670 (YetO)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
718900..722082
Genome map
AA seq 1060 aa AA seqDB search
MKETGPIPQPKTFGPLGNLPLLDKDKPTMSLIKLANEQGPIFQLHTPAGAIIVVSGHELV
KEVCDEERFDKSIEGALEKVRAFSGDGLFTSWTHEPNWRKAHNILMPTFSQRAMKDYHSM
MTDIAVQLIQKWARLNPDEAVDVPADMTRLTLDTIGLCGFNYRFNSYYRETPHPFINSMV
RALDEAMHQMQRLDVQDKLMIRTKRQFHHDIQAMFSLVDSIIAERRSGGRDEKDLLARML
NVEDPETGEKLDDKNIRFQIITFLIAGHETTSGLLSFAIYFLLKHPRVLDKAYEEADRVL
TDPVPSYKQVLDLTYIRMILQESLRLWPTAPAFSLYAKEDTVIGGKYPITPKDRISVLIP
QLHRDKDAWGDNAEEFYPERFEHPDQVPQHAYKPFGNGQRACIGMQFALHEATLVLGMIL
QHFTFIDHTDYELDIKQTLTIKPGDFHIRVRPRNKGAVAAALPAAEKAAGDVEKEKRETK
GASIIGLDNRPLLILYGSDTGTAEGVARELADTAGMHGVRTETAPLNDRIGKLPKEGALL
IITSSYNGKPPSNAGQFVQWLEEVKPGELEGVRYAVFGCGDHNWAATYQAVPRLIDEKLA
EKGAERFSSRGEGDVSGDFEGKLDEWKKSMWTDAMKAFGLKLNENAEKERSSLGLQFVSG
LGGSPLAKTYEAVYASVAENRELQAPESGRSTRHIEITLPKEAAYHEGDHLGVLPVNSKE
QVSRVLRRFNLNGNDQVLLTASGQSAAHLPLDRPVRLHDLLSSCVELQEAASRAQIREMA
AYTVCPPHKRELEDFLEEGVYQEQILTLRVSMLDLLEKYEACELPFERFLELLRPLKPRY
YSISSSPRKHPGQASITVGVVCGPARSGLGEYRGVASNYLADRGPEDGIVMFVRTPETRF
RLPEDPEKPIIMVGPGTGVAPFRGFLQARAALKKEGKELGEAHLYFGCRNDHDFIYRDEL
EAYEKDGIVTLHTAFSRKEGVPKTYVQHLMAKDAGALISILGRGGHLYVCGDGSKMAPDV
EATLQKAYQSVHETDERQAQEWLLDLQTKGIYAKDVWAGI
NT seq 3183 nt NT seq  +upstreamnt  +downstreamnt
atgaaggaaacaggtccgattccgcagccgaagacatttggcccgctcggcaatcttcct
ttgcttgataaagacaagcctacaatgtcgcttatcaaactggcaaacgagcaggggcct
atttttcagctgcatacgccggcgggcgccattatcgtcgtgtccggccatgaactggtg
aaagaggtttgtgatgaagagcggttcgataaaagcattgaaggggctttagagaaagtc
cgggcgttttccggtgacgggctgtttacaagctggacgcatgagcctaactggcgaaag
gcgcataatattctgatgccgaccttcagccagcgcgcgatgaaagattatcattcgatg
atgactgatatcgcggtgcagctgattcaaaaatgggctaggctgaacccggatgaggcc
gttgatgtgcctgctgatatgacccgcctgacgctcgatacgatcgggctttgcggcttt
aactatcggtttaacagctattacagggaaacgcctcatccgtttatcaacagcatggtg
cgcgcccttgatgaagcgatgcaccaaatgcagcgccttgatgttcaggataagcttatg
atcaggacgaagcgccaatttcatcatgacattcaggcgatgttttcgttagtagacagt
attatcgcagagcgccggtcaggcggccgggatgaaaaggatctgctggccagaatgctg
aatgtggaagacccggaaacgggcgaaaaacttgatgataaaaatatccggtttcaaatc
atcacgtttttaattgccggccacgaaacgaccagcggcctgctttcctttgccatttat
tttctgctgaaacatccccgtgttttggataaagcctatgaggaagccgatcgggtattg
accgatcccgttccttcatataaacaagtgctggatcttacttatatccgaatgattttg
caggagtcattgcgcttatggccgaccgcgcctgcgttcagcctttatgcgaaagaggat
acggtgatcggcgggaaatatccgatcacgccgaaagacagaatttccgtcttaattccc
cagcttcaccgtgataaagacgcgtggggagacaatgcggaggaattttatccggagcgg
tttgaacatcctgatcaagtgcctcaacatgcgtataagccgttcggaaacggtcagagg
gcgtgtatcggtatgcagttcgccctgcatgaagcaacccttgttctggggatgattctg
cagcattttacctttatcgatcacaccgattatgagctcgatattaaacagacgctaacg
atcaagcccggcgactttcatatccgggtgcggccgagaaacaaaggagccgttgcggca
gccctcccggcggctgaaaaagcggcgggagatgtcgaaaaagaaaaacgggaaacaaaa
ggcgcatccattatcgggcttgataaccgaccgcttctgattttgtacggctcagatacg
ggaaccgcagaaggcgtggcgcgggagcttgctgatactgccgggatgcacggcgtccgg
actgaaacggcgcctttaaatgaccggatcggaaaactgccgaaagaaggagctctcttg
atcattacgtcttcttataacggaaagcctccgagcaacgcgggacaattcgttcaatgg
cttgaagaagtcaaacccggggagctggaaggcgtccgatatgccgtcttcggctgcggt
gatcataactgggcggcgacatatcaggccgtgccgaggcttattgatgagaagcttgcc
gaaaaaggggcggaacgcttttcctcccgaggcgaaggggacgtcagcggcgattttgaa
ggaaagcttgatgaatggaaaaaaagcatgtggacggacgccatgaaggcattcggtctc
aagctgaatgaaaatgccgaaaaagagcgaagttcgctgggccttcaatttgtcagcggg
cttggcgggtcccctttggcaaagacgtatgaagcggtttacgcatccgttgcggaaaac
agggaacttcaggcgccggaaagcggccggagcacaaggcatatcgaaatcactctgccg
aaagaggctgcctatcatgaaggggatcatctcggcgtgctgccggtaaacagcaaagag
caggtcagccgtgttctccgccggttcaatctgaatgggaatgatcaagtgctgctgacg
gccagcggacagagcgcggctcatctccccctcgatcggccggtcaggctgcatgatctt
ctgagcagctgtgtcgaattgcaggaagcggcatcaagggctcaaatccgggaaatggcc
gcttatacggtctgcccgccgcacaaacgggaattggaagattttcttgaggagggcgtc
tatcaggagcaaatcttaacattgcgcgtctcgatgctcgatctccttgaaaaatatgaa
gcgtgtgaacttccgtttgagcgatttctggagcttttgcgcccgctgaagccgcggtat
tattcgatttcaagttcgccgcggaaacatcccgggcaggcttcaattaccgtcggcgtc
gtttgcggccccgcccggagcggtttgggtgagtatcgcggagtcgcttcgaattattta
gcggatcgcggccctgaggatggtatcgtgatgtttgtccgcactccggaaacacgattc
cggctgccggaagatccggaaaaaccgattattatggtcggtcccggcacaggagtcgcc
ccgttccgcggatttctgcaggcccgggcggcgttaaaaaaagaaggaaaagagctgggg
gaggctcatctgtatttcggatgcagaaacgatcatgattttatttaccgtgacgagctt
gaagcttatgaaaaagacggaatcgtgacgcttcatacggctttctcccgcaaagaaggc
gtaccgaaaacgtatgtgcagcacttaatggcgaaagacgccggcgctttaatttccatc
ctcggccggggagggcacctctacgtatgcggcgacggcagcaaaatggcgcccgatgta
gaggcaacgctgcaaaaagcgtatcagtcggtccacgaaacagacgaacggcaagcgcaa
gaatggcttttggacctccagacaaaaggcatttacgcaaaagatgtttgggccgggatt
tga

DBGET integrated database retrieval system