KEGG   Bacillus amyloliquefaciens subsp. plantarum NAU-B3: BAPNAU_1137Help
Entry
BAPNAU_1137       CDS       T02859                                 

Gene name
yrhJ
Definition
putative cytochrome P450/NADPH-cytochrome P450reductase YrhJ (EC:1.14.14.1)
Orthology
K14338  
cytochrome P450 / NADPH-cytochrome P450 reductase [EC:1.14.14.1 1.6.2.4]
Organism
bamb  Bacillus amyloliquefaciens subsp. plantarum NAU-B3
Pathway
Fatty acid degradation
Tryptophan metabolism
Aminobenzoate degradation
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bamb00001]
 Metabolism
  Lipid metabolism
   00071 Fatty acid degradation
    BAPNAU_1137 (yrhJ)
  Amino acid metabolism
   00380 Tryptophan metabolism
    BAPNAU_1137 (yrhJ)
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    BAPNAU_1137 (yrhJ)
Enzymes [BR:bamb01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     BAPNAU_1137 (yrhJ)
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     BAPNAU_1137 (yrhJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1211089..1214250
Genome map
AA seq 1053 aa AA seqDB search
MKQLSAIPQPKTYGPLKNLPHLEKEKLSQSLWKIAEEYGPIFRFEFPSSVGVFVSGRELA
AEVCDEKRFDKNLSKALLKVREFGGDGLFTSWTHEKNWQKAHRILLPSFSQKAMKGYHSM
MLDIAMQLVQKWSRLNPNEEIDVAEDMTRLTLDTIGLCGFHYRFNSFYRDTQHPFITSML
RALQEAMRQSQRHSLQDKLMIKTRHQFQQDIEEMNSLVDRIIAERRENPDENLSDLLALM
LEAKDPVTGERLDDENIRYQIITFLIAGHETTSGLLSFAIYCLLKNKDKLKKAVQEAERV
LTGETPEYKQIQQLTYIRMVLNETLRLYPTAPAFSLYAKEDTVLGGKYPIEKGQPVTILT
PQLHRDKSAWGEDAESFRPERFSDPAAIPADAYKPFGNGQRACIGMQFALQEATMVLGLV
LKHFELIDHTDYELTIKEALTIKPGDFKIRVKNKDVSNHQPVQNHKAEGSGHKEETKEIP
SHGTPLLILYGSNLGTAEGIAEELADIGRSKGFSTETGPLDDYAGKLPVKGAVVIVTASY
NGAPPDNAAGFVKWMETLEDQELKGVSYAVFGCGDRNWAATYQRIPRLIDKVLEEKGAKR
LTSIGEGDNADDFEYSQEAWEDSFWKDIMKTFHIEAAPKQTNKSQLSIEYVSEAAETPIA
KTYKAFEAEVITNKELHTESSKRSVRHIELRLPETETYQEGDHLGVLPQNSGELISRVIR
RFGLDPNQHFKIKGRQLPHLPMDRPVNAPELLASYVELQEPATRAQLRELAAHTVCPPHQ
KELEHLYSDDAAYKENVLKKRMTMLDLLEDYPACELPFERFLELLPSLKARYYSISSSPK
AASGELSITVGVVTAPAWSGRGEYRGVASNYLAGLQNGDPAVCFIRSPQSGFALPENPKT
PLIMVGAGTGIAPFRGFIQARAAEKMSGNSLGEAHLYFGCRHPEEDDLYKDEFDDAEKNG
LVTVHRAYSRLDQDCKVYVQDVLLREAAQIIALLDQGGHLYICGDGSKMAPAVENVLLQA
YEKVHNTDSKVSLNWLEQLQAEGRYAKDVWAGM
NT seq 3162 nt NT seq  +upstreamnt  +downstreamnt
atgaaacagctaagcgctataccgcagccgaaaacatacgggcctctgaaaaatctccct
cacttggaaaaagaaaaactgtcacaatctctttggaaaattgccgaagaatacggcccg
atctttcgttttgaatttccgagctctgtcggggtcttcgtatcaggccgcgagctcgcg
gcagaagtctgtgatgaaaagcgatttgacaaaaatctcagcaaagccctgctgaaagtc
cgtgagtttggcggtgacggactatttacgagctggactcacgaaaagaactggcagaaa
gcgcatcggattttattgccgagcttcagccagaaggcgatgaaaggctatcattcaatg
atgctggatattgccatgcagctcgtgcagaaatggagcagattaaatccgaatgaagaa
attgacgttgccgaagatatgacgcgcctgacgctggatacaatcggcctgtgcggattt
cattaccgctttaacagcttttaccgcgacacacagcatccttttatcacaagtatgctt
cgtgcgctgcaggaggcaatgcgccaatcgcagagacacagcctgcaggacaagctgatg
atcaaaacgagacatcaattccagcaggatattgaagagatgaattcgcttgtagaccgg
atcatcgctgagcggagggaaaatccggatgagaatctgtctgaccttttagcattgatg
cttgaagcgaaagaccctgtaacgggggaaaggctggatgatgaaaatatccgttatcaa
atcatcacctttttgatcgctgggcatgaaaccacaagcgggctgctttcttttgcgata
tactgcctgctgaaaaataaagataaattgaaaaaagccgttcaggaagccgagcgagtg
ctgacgggagagacacctgaatataagcagattcagcagctgacatatatccgcatggtg
ctaaacgagactttgcggctgtatccgactgccccggcattttctctgtacgcgaaggaa
gatacggttctcggcgggaagtatccgattgagaagggacagccggtgacgattctgact
ccgcagctgcaccgggataaaagtgcgtggggagaagatgccgagtcattccgcccggaa
aggttcagcgatcccgcggccattccggctgatgcgtataagccgttcggaaacggacag
cgcgcatgcatcgggatgcagtttgccctgcaggaagcgacaatggtgctcggccttgtc
ctgaaacactttgaactgattgatcatactgattatgagcttacgattaaagaagctcta
accattaagcccggtgattttaaaatccgtgtgaaaaacaaggacgtgtccaatcatcag
cccgtacaaaaccataaagctgaaggaagcggtcacaaagaagaaacgaaagaaatcccg
tcccacggaacaccgcttctcattctttacggatcaaatttaggaactgcggaaggaatc
gcggaagagctggctgatatcggaagaagcaaaggattttcaactgaaaccggcccgctc
gatgattatgccgggaaactgcctgtaaaaggcgcggtcgttattgttacggcttcttat
aacggggcgccgcctgataatgcggcgggttttgtgaaatggatggaaacccttgaagat
caggaattaaagggtgtttcttacgccgtcttcggctgcggagaccgcaactgggctgcc
acttaccagaggatcccccgcctgatagacaaagtgcttgaagaaaaaggggcaaaacgg
ctgacctctatcggagagggcgacaatgccgatgattttgagtacagtcaggaagcctgg
gaagactcattctggaaggacatcatgaagacttttcatatagaggccgctccaaaacag
acaaacaaatcacagttatcaatcgaatacgtaagtgaagcagccgagacgccgattgcc
aaaacgtacaaagcatttgaggcggaggtcatcacgaacaaagagcttcataccgaaagc
agcaagcgctcagtccggcatattgagctgcgtctccccgaaacagaaacgtatcaggaa
ggagatcatctcggggtgcttccgcaaaacagcggggaactgatcagccgtgtcattcgc
cgattcggtcttgatccgaaccagcactttaagatcaagggccggcagctgcctcatctg
ccgatggaccggccggttaatgcgccggagcttttggcgtcctatgtagagctgcaggag
ccggcaacgagagcccagcttcgcgaacttgccgcacataccgtgtgcccgccgcaccaa
aaagaattggagcatctttattctgatgatgcggcatataaagaaaacgtgctgaaaaaa
cgaatgaccatgctggacctgctggaagattatcctgcatgtgaactgccgtttgagcgc
tttttagaacttctgccgtccttaaaggcgcgctattattcaatctcaagctcaccgaag
gcagccagcggggagctcagtatcacggtcggcgttgtgacggctccggcatggagcggc
cgtggggaataccggggcgtggcttcgaactatttagccggattacagaatggcgatcct
gccgtctgtttcatccgctcgccgcagtcgggtttcgcattgcctgaaaatccgaaaacg
cctctcattatggtcggagcaggcacaggaattgcgccgttcaggggatttatccaggcg
cgggctgccgaaaaaatgtccggtaacagcctgggcgaagctcatttatacttcggctgc
cggcatcctgaagaagacgatctgtacaaagatgaattcgacgatgcggagaaaaacggc
cttgtcaccgtgcatcgggcgtattccagattagatcaggactgtaaagtttacgtacag
gatgtcctgcttcgcgaggctgcacaaattattgcgcttcttgaccaaggcggccatctc
tatatatgcggcgacggaagcaaaatggctccggccgtcgaaaatgtactgcttcaggcg
tatgaaaaggtgcataacactgattcaaaagtttccttgaattggcttgaacagctgcag
gcggaaggaagatatgcgaaagatgtttgggcaggtatgtaa

DBGET integrated database retrieval system