KEGG   Bacillus velezensis NAU-B3: BAPNAU_2744Help
Entry
BAPNAU_2744       CDS       T02859                                 

Gene name
yhfS
Definition
(GenBank) acetyl-CoA C-acetyltransferase
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bamb  Bacillus velezensis NAU-B3
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:bamb00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BAPNAU_2744 (yhfS)
   00630 Glyoxylate and dicarboxylate metabolism
    BAPNAU_2744 (yhfS)
   00640 Propanoate metabolism
    BAPNAU_2744 (yhfS)
   00650 Butanoate metabolism
    BAPNAU_2744 (yhfS)
  Lipid metabolism
   00071 Fatty acid degradation
    BAPNAU_2744 (yhfS)
   00072 Synthesis and degradation of ketone bodies
    BAPNAU_2744 (yhfS)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BAPNAU_2744 (yhfS)
   00310 Lysine degradation
    BAPNAU_2744 (yhfS)
   00380 Tryptophan metabolism
    BAPNAU_2744 (yhfS)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BAPNAU_2744 (yhfS)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BAPNAU_2744 (yhfS)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BAPNAU_2744 (yhfS)
Enzymes [BR:bamb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BAPNAU_2744 (yhfS)
Exosome [BR:bamb04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BAPNAU_2744 (yhfS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
2916467..2917558
Genome map
AA seq 363 aa AA seqDB search
MEAVITDAKRTIFARENGLLKDCLPEDLAAPLIRHLSRNMPEDIDEVLIGNATGRGGNLA
RLSALAAGLPLSVSGTTIDRQCGSGLDAVRVACHFVKAGAGSMYIAGGAESSSRSPFSSR
ARFSPEHIGDPDMGIAAEYTAQAYGVTRKMQDEYALLSYERSVKANEDGLYRREILPCHG
FAADENMLKKRNMEPLISRAKPVFQSGGSVTAANSCGISDGAAAVCVMEEQKARSLGLKP
RLRFIGSAVSGVHPHYPSAAPVYAVKKLLKERNLSPDDIDIYEINEAFAVKICVFSQQLQ
VPYSKINVRGGALAVGHPYGASGAALVTRLFYEAKRRPDARYAAAAIGSGGGVGLALLFE
VLT
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atggaagctgtaattacggatgcgaaacggacgattttcgcccgggaaaacggcctgtta
aaagactgtctcccagaagatttggcagctccgctgattcgccatttgagccgaaacatg
cccgaagacattgatgaagtcctgatcggaaacgcgacgggccgcggcgggaatctcgcc
cggctgtcagccttggccgccggacttcctttgagcgtgtccggtacgaccatcgacaga
cagtgcggctccggactggacgccgtgagggtcgcgtgccactttgttaaagccggcgcg
gggagcatgtacatcgcgggaggagcggagagcagcagccgttcccctttctcttcccgg
gcgcgcttttctcctgaacacatcggcgatcctgatatgggcatagcagccgagtatacg
gcacaggcttacggcgtaacgagaaagatgcaggacgaatatgcccttctcagctatgaa
cggagcgtcaaagcgaacgaagacggcttataccgccgggaaattcttccctgtcacgga
ttcgccgctgacgaaaacatgctgaaaaagcggaacatggagcctctcatctcccgtgcc
aaacccgtctttcagtccggaggctctgtcaccgccgccaacagctgcggaatttctgac
ggtgcggcggcagtttgtgtgatggaagaacaaaaagcgcggtctctcggtttaaagcca
agattgcgttttatcggaagcgcggtaagcggcgtccatccgcattatccgtcagcagcc
ccggtttatgccgtcaaaaagcttttgaaggaacggaacctgtcaccggatgatattgat
atatacgaaatcaacgaggcgtttgccgtcaaaatatgcgttttttcacagcagcttcaa
gtgccgtattctaaaataaatgtccggggcggcgctctggccgtcgggcatccgtacggg
gcttccggggcggcgcttgtcacccggcttttttatgaagcaaaaagacgcccggatgcc
cgctacgcagcagcagcgatcggcagcggaggcggagtcggactggcgcttctctttgaa
gtgttaacgtaa

DBGET integrated database retrieval system