KEGG   Bacillus amyloliquefaciens subsp. plantarum NAU-B3: BAPNAU_3007Help
Entry
BAPNAU_3007       CDS       T02859                                 

Gene name
tgl
Definition
transglutaminase (EC:2.3.2.13)
Orthology
K00686  
protein-glutamine gamma-glutamyltransferase [EC:2.3.2.13]
Organism
bamb  Bacillus amyloliquefaciens subsp. plantarum NAU-B3
Brite
Enzymes [BR:bamb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     BAPNAU_3007 (tgl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3186425..3187162
Genome map
AA seq 245 aa AA seqDB search
MIIISGQVLRPQDIANWQTEENLVPYINELLNSPVQFDYGSIAELMFEVRLRRHIVEAAR
ELHGSGVKFATFAKTYGNTAYWRVTPEGALELKYRIPASKAIRDIIENGAFYAFECATAI
VVIYYLAVLKTMGEERFNRRFRDITLYDWHYEHLPIYTETGSHFLRGDCLYFKNPDFNPA
KAQWRGENVIVMGNDQYFAHGLGILTAEQIIQRLNSLRKKNAVQPAYLLNQATRLDAPAL
YQIMH
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atgattatcatatccggccaagtgcttcggcctcaggacatcgcgaactggcagacggaa
gaaaaccttgttccgtatataaatgaactgctcaattctcccgtacaattcgattacggg
tcgattgcggaactgatgttcgaggtgcggctgcgccgccatattgtggaagccgcaaga
gaactgcacggatcaggtgtgaaatttgcaactttcgccaaaacatacggaaatacggct
tattggagagtgacgccggaaggagccttggagctgaagtacagaatccccgcttcaaaa
gcgattcgggacattattgaaaacggggcgttttacgcatttgaatgcgctaccgccatt
gttgtgatttattatctggccgtcttaaagacaatgggtgaagaacggtttaaccggcgt
ttccgggatatcactttgtatgactggcactacgagcatctgccgatctacacggaaacc
ggcagccactttttacggggagattgtttatattttaaaaatcctgattttaatcctgca
aaggctcagtggcggggagagaatgtcattgtgatggggaatgatcaatatttcgcccac
ggtctcgggattctgacggctgaacaaatcatccagagattgaattctttaagaaaaaaa
aatgccgtgcagccggcttatctgcttaaccaggcaacaaggcttgatgcacccgcgctt
tatcagatcatgcattaa

DBGET integrated database retrieval system