KEGG   Bacillus amyloliquefaciens CC178: U471_01590Help
Entry
U471_01590        CDS       T02893                                 

Definition
4-aminobutyrate aminotransferase
Orthology
K00823  
4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
bamc  Bacillus amyloliquefaciens CC178
Pathway
Alanine, aspartate and glutamate metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bamc00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    U471_01590
   00650 Butanoate metabolism
    U471_01590
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    U471_01590
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    U471_01590
Enzymes [BR:bamc01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     U471_01590
Amino acid related enzymes [BR:bamc01007]
 Aminotransferase (transaminase)
  Class III
   U471_01590
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
174237..175505
Genome map
AA seq 422 aa AA seqDB search
MGTKEITNPDSLYYSVDDVVMERGEGIYLYDQEGNEYIDCASATFNLNLGYGNKEVIDTV
KEQADKLIHVTSSFQTDAVNKLAEKLVEIAPDNLTKVHPKVSSGSGANEGAIKMAQYYSG
KTDVISLFRSHLGQTYMTSALSGNSFRKEPFPPQISFGLQVPDPYCSRCFYNQKPDSCGM
LCVERINDFIEYASNGKIAAMIIEPISGNGGNVVPPKEYFKQLRKLCDEHDIALIFDEIQ
TGFGRTGKMFAADHFDVKPNMMTVAKGLGGTGFQVAATLTEDKYTGLPGYTHSFTYGSNV
MAAAAACKTIDIMQRPGFLENVTTVGHYIMDRLETMKEDFAFISEVRGVGLMIGVEIVKE
NNEPDVELTNYIAKRAMDYGLILRTSRYGFGNVFKIRPPLTITLSEAEVLCYRLRKLLEE
IK
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
gtgggaacgaaggaaatcacgaatccagacagcttgtattacagtgttgacgatgtagta
atggagcgcggagaagggatttacctgtacgatcaagagggaaatgagtacattgattgc
gcttctgccacgtttaacttgaatttaggatacggtaacaaagaggtcattgatacggtt
aaagaacaagccgataagctgatccatgtaacatcatcttttcaaacagacgccgtaaat
aaactggcagaaaaactagtagaaattgcccccgataatctcacaaaagtacaccctaaa
gtcagcagcggttccggtgcaaatgaaggagctattaaaatggctcagtattactccgga
aaaaccgatgtcatctccttatttcgaagccacctcggacaaacgtatatgacttccgct
ttgtccggcaactcattcagaaaagaacctttcccgccgcaaatttcttttggcctgcaa
gtccccgatccctattgcagccgctgtttttataatcagaaacctgattcatgcggtatg
ctgtgcgtagaaagaattaatgattttattgagtatgcgagcaatgggaaaattgccgcc
atgattattgaaccgatatctggaaacggtggaaatgtcgttccgcctaaagagtatttt
aaacagctgagaaagctttgtgatgaacatgatatcgctctgatttttgatgaaattcag
accggattcggacggacgggcaaaatgtttgccgcggaccacttcgatgtgaaacctaat
atgatgacggtagcaaaggggctcgggggcacaggcttccaagtcgccgccactctgacg
gaggacaagtataccgggcttccggggtatacgcactccttcacatacggctcaaatgtg
atggccgccgctgccgcttgtaaaaccatagatatcatgcagcgaccgggatttttggaa
aatgtaacgacggtcggtcattatattatggatcgcttagaaacgatgaaagaggatttc
gcttttatttctgaggtaagaggcgtcggtcttatgatcggtgtggagattgttaaagag
aacaatgaaccggatgtggagctgaccaattatattgcaaaacgggcaatggattacggg
ctgattctccggacatcccgttacggattcggaaatgtctttaaaatccgtccgccttta
accataacacttagtgaagccgaagtgctctgctacagacttcgcaagctattggaggaa
atcaagtga

DBGET integrated database retrieval system