KEGG   Bacillus amyloliquefaciens CC178: U471_09490Help
Entry
U471_09490        CDS       T02893                                 

Definition
phoA (EC:3.1.3.1)
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
bamc  Bacillus amyloliquefaciens CC178
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:bamc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    U471_09490
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    U471_09490
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    U471_09490
Enzymes [BR:bamc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     U471_09490
Exosome [BR:bamc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   U471_09490
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(941141..942520)
Genome map
AA seq 459 aa AA seqDB search
MSLFKQVRSKLLPAAAVSVLTAGLIAGAGLQHSEQAAAKKQPDKNEIRNVIFMVGDGMGA
PYMNAYRSVINKGKPSDGMKLTAFDPNLTGMMMTYPDDPDSNITDSAAAGTAMATGVKTY
NAAIGVDKKGKRVKSVLEEAKQRGKSTGLVATSEIAHATPAAFGAHNKSRKNMDDIASSY
FDDRINGKQKVDVLLGGGKLNFIRKDRNVTKDFKKAGYSYVTSKQELKKDRNKKILGLFA
DGGLDKAIDRSNAVPSLEDMTTAAIDRLNKNKKGFFLMVEGSQIDWAGHDNDIVGAMSEM
KDFEKAYKAAIAFAKKDKHTLVVATADHTTGGLTIGANDDKNWHVEPILAAKKTPAFMAD
QIKAGKSVSSVLARYTDLKWSKAEIKQIETAAKQDADKSIYKAIIKLFNAKTNSGWTTGD
HTGEEVPVYAYGPGRESFTGLLNNTDQAKKIFHILKHGK
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
atgagtctatttaaacaggttcgatcaaaacttctgccggctgcagccgtatccgtgctg
acagccggtctgattgcgggtgcggggcttcagcactccgaacaggctgcggcaaaaaaa
cagcctgacaaaaacgaaatcagaaacgtcatcttcatggtcggcgacggaatgggcgct
ccctatatgaacgcctaccgttcggtcattaacaaaggaaagccttcggatggtatgaaa
ctgacggcattcgatcccaatctcaccggtatgatgatgacttatcctgacgatcctgat
tccaatattaccgattccgcggcggctggcacggcaatggccacgggcgtgaaaacgtat
aacgcggcgatcggagtcgataaaaaaggaaagcgggtaaaatccgtcctcgaagaagcg
aaacaaagagggaaatccaccggacttgtcgcaacttcggagattgcccacgccacccct
gcggcattcggagcccataacaaatcccgaaagaacatggatgacatcgcaagcagctac
tttgatgaccgcatcaacggaaaacagaaagtcgatgtgctcctcggaggcggcaagtta
aactttatccgtaaagaccgcaatgtaacaaaggatttcaaaaaagcgggatacagctac
gtgacatcaaaacaggagctcaaaaaggatcgtaacaagaagattctcggcctgtttgcc
gatggcggactcgacaaagcaatcgaccgctcaaacgccgtcccttcattagaagacatg
acaacggcagcgatcgacaggctgaacaagaataaaaaagggtttttcttaatggtcgaa
ggcagccaaattgactgggcgggacatgacaatgatatagtcggcgcaatgagtgaaatg
aaggattttgaaaaagcgtataaagcagcgatcgcatttgccaaaaaggacaaacatacg
cttgtcgttgccacggctgaccataccaccggcggattgacgatcggcgcgaatgacgat
aaaaactggcatgttgaaccgattcttgccgcaaaaaaaactccggcatttatggctgac
caaatcaaagcgggcaaatccgtatcttccgtgcttgcgcgctatacagacctgaaatgg
tcaaaggcggaaatcaaacagatcgaaacggccgcaaaacaggatgctgacaagagcatc
tacaaagcaatcattaagctctttaatgcgaaaaccaacagcggctggacaaccggcgat
catacaggcgaagaagttcccgtttacgcatacggtccgggaagagagtcatttacgggg
cttttaaacaacacagaccaggccaaaaagatctttcacatcctgaaacacggaaaataa

DBGET integrated database retrieval system