KEGG   Bacillus amyloliquefaciens CC178: U471_10290Help
Entry
U471_10290        CDS       T02893                                 

Definition
protoporphyrinogen oxidase (EC:1.3.3.4)
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
bamc  Bacillus amyloliquefaciens CC178
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bamc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    U471_10290
Enzymes [BR:bamc01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     U471_10290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1010775..1012208
Genome map
AA seq 477 aa AA seqDB search
MSGDKKHLVIIGGGITGLAAAFYMEKEIKEKQLPLEVTLIEAGPRAGGKIQTQHKDGYII
ERGPDSFLERKKSAPQLVKDLGLEHLLVNNATGQSYVLVNETLHPMPKGAVMGIPTKIAP
FISTGLFSVPGKARAALDFVLPASKPKEDQSLGEFFRRRVGDEVVENLIEPLLSGIYAGD
IDKLSLMSTFPQFYQTEQKHRSLILGMKKSRPQPSGQQLTAKKQGQFLTLTTGLQTLVEE
LEKQLTLTKVMKGTKVTHIGREEKGYSVTLDNGKVLYAEGCIVTAPHKAAAKMLSDLPAV
SCLKDMHSTSVANVALGFPEGAVKMEHEGTGFVISRNSDFSITACTWTNKKWPHAAPEGK
TLLRAYVGKAGDESIVDLSDNEIIKIVMEDLKKVMKINGEPEMTCVTRWNESMPQYHVGH
KERIKEFRDALKASYPGVYATGASFEGVGIPDCIDQGKAAVYDSLAYLFETYQPPLS
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgagtggcgataaaaaacatctggtcatcatcggcggcggcataacgggattagccgcc
gccttctacatggaaaaagaaatcaaggaaaaacagctgccgcttgaggtcaccctgatt
gaagcgggcccgagagcgggcggcaaaattcagacgcagcataaagacggctacatcatt
gagcgggggccggattcttttttggaaaggaaaaaaagcgcgccgcagctcgtcaaggat
ttggggcttgagcatctgctcgtcaacaatgcgaccggccagtcttacgtgctcgtcaac
gagacgctccatccgatgccgaagggcgcggtgatgggcattccgaccaaaatcgctccg
ttcatctccaccggtttattttctgttcccggaaaggcgcgggcggcgcttgactttgtc
ctgcctgcgagcaaaccgaaggaagatcagtctctgggtgaatttttccgcagacgcgtc
ggtgacgaagtcgttgagaatttaatagaaccgctattatcagggatttatgccggagat
attgataagctgagcctcatgtccacgtttccgcaattctatcagactgagcagaagcac
agaagcctgattctcggcatgaaaaaatcgcgtccgcagccttcgggacagcagctgacg
gctaaaaagcagggccagtttttaacgctgacgacagggcttcaaacgttggtggaggag
ctggaaaagcagcttacgctgacaaaggtgatgaaaggaacgaaagtcacccatatcggc
cgcgaggagaagggatactccgtgacgcttgataacggcaaagtgctctatgcggaagga
tgcattgtgacagccccgcataaagccgcggcgaaaatgctttctgatctgccggcggtt
tcatgtcttaaagacatgcattctacgtccgttgccaacgtcgccttaggttttcctgag
ggagccgtcaagatggagcatgaaggtacgggattcgttatctcaagaaacagcgacttc
tccatcacggcctgcacatggacgaataaaaaatggccgcacgcggcgccggagggcaaa
acgcttctcagggcgtacgtcggaaaggccggagatgaatccatcgtagatctttcagat
aacgagatcattaaaatcgtaatggaagatttgaaaaaagtaatgaaaataaatggtgaa
ccggaaatgacctgtgtgacccgctggaacgaaagcatgccgcaataccatgtcggccat
aaggagcgcatcaaagagttcagagatgcgctgaaagcttcctatccgggcgtatacgcg
acgggcgcgtctttcgaaggggtgggcatccccgactgtatcgaccagggaaaagccgcc
gtatacgattcactggcttatttatttgaaacgtaccagcctccgttatcgtaa

DBGET integrated database retrieval system