KEGG   Bacillus amyloliquefaciens CC178: U471_17820Help
Entry
U471_17820        CDS       T02893                                 

Definition
xylose isomerase (EC:5.3.1.5)
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
bamc  Bacillus amyloliquefaciens CC178
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bamc00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    U471_17820
   00051 Fructose and mannose metabolism
    U471_17820
Enzymes [BR:bamc01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     U471_17820
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1796808..1798145
Genome map
AA seq 445 aa AA seqDB search
MAHSHSGSVNYFESANKVIYEGKESTNPLAFKYYNSQEVIGGKTMKEHLRFSIAYWHTFT
ADGTDIFGAATMQRPWDHYKGMDLARARVDAAFELFEKLDAPFFAFHDRDIAPEGSTLKE
TNQNLDLIVDMIKDYMRTSGVKLLWNTANMFTNPRFVHGAATSCNADVFAYAAAQVKKGL
ETAKELGAENYVFWGGREGYETLLNTDLKFELDNMARFMHMAVDYAKEIGYTGQFLIEPK
PKEPTTHQYDTDAATTIAFLKQYGLDNHFKLNLEANHATLAGHTFEHELRMARVHGLLGS
VDANQGDPLLGWDTDEFPTDLYSATLAMYEILKNGGLGSGGLNFDAKVRRSSFEPDDLLY
AHVAGMDTFARGLKAARKLIEDRVFEDVIQHRYRSFTEGIGLEIAEGRADFKTLEQYALN
NQPIKNESGRQERLKAILNQYILQV
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atggctcactctcattccggttcggtcaactattttgaaagcgcaaacaaagtgatttac
gaagggaaagaatccacgaatcctttagcatttaaatactataattctcaagaagtaatt
ggcggaaaaacgatgaaagagcatttgcgattttctattgcctattggcatacatttacc
gctgacggcacagacatttttggcgcagctacgatgcagagaccgtgggatcactataaa
ggcatggatctggcgagagcgagggtagatgcagcgtttgagctgtttgaaaaactggat
gcgccattttttgcttttcatgaccgggatatcgcaccggaaggaagtacgttaaaagag
acaaatcaaaatctggatttaatcgtggatatgataaaagactacatgagaaccagcggc
gttaagttattatggaatactgcaaacatgtttacgaatccccgtttcgtccatggtgcg
gcgacttcttgtaacgcagatgtatttgcgtatgccgcagcccaagtaaaaaaaggatta
gaaacagcaaaagagcttggcgcggagaactatgtattttggggcggacgtgaagggtac
gaaactttgttaaataccgatttaaaatttgagcttgataatatggccagatttatgcat
atggcagtggattatgcgaaggaaatcgggtatacagggcagtttttgattgaaccaaaa
ccaaaagagccgaccacccatcaatatgatacggacgcagcaacaactattgccttttta
aagcaatatggcttagacaatcattttaaattaaatctcgaagccaatcatgccacatta
gccgggcatacattcgaacatgaattacgcatggcgagagtgcatggccttcttggctct
gttgacgcgaatcagggtgatccgcttttaggctgggacacagatgaatttccgacagat
ttatattctgcgacattagcaatgtacgaaatcctgaaaaatggcggtcttggaagcgga
ggattaaactttgacgcaaaggtcaggagatcttcttttgagcctgatgatttactatat
gcccatgttgcagggatggatacatttgcaagaggattgaaagccgcccgcaaattaatc
gaagatcgtgtgtttgaagatgtgattcaacaccgttaccgcagctttactgaagggatt
gggcttgaaattgcagaaggaagagctgattttaagacacttgagcaatatgcgctgaac
aatcagccaattaaaaacgaatcaggtagacaggagcggttaaaagcgatattaaaccaa
tacattttacaggtataa

DBGET integrated database retrieval system