KEGG   Bacillus amyloliquefaciens CC178: U471_19970Help
Entry
U471_19970        CDS       T02893                                 

Definition
hypothetical protein
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
bamc  Bacillus amyloliquefaciens CC178
Pathway
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bamc00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    U471_19970
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    U471_19970
Enzymes [BR:bamc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     U471_19970
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2050091..2051560)
Genome map
AA seq 489 aa AA seqDB search
MFLKKGLHMTLVFLMFFFFISSSMETEVYAADRKASDKNKVRVWFSSEKDPASRTWYDGP
LEVKYALDEQTPLALTKKKASDSAAVYIDPSRRYQSVLGVGSSLEESTIHNLSKMTPAKR
KEVLKKLVDPKDGIGMDVMRITIGTSDFTAQEFYTYDDMPEGQTDPKLHHFSIQKDIDLH
ITATIKEALAINPELKIIASPWSPPAWMKTNENLKRGKLKDKYIGALAVYFRKFIEAYEK
QGIPIYAMTLQNEPLLEIDYPSMYMPPSQQRKLALALKKEMKKHVIDTKIWIYDHNASGA
WNYIPPILDDKKGNRAADGIAFHDYDGDLSVMSEIGKRYPDKSIHLTERSVWGTAGADRI
AQYFRNGASSYNAWVTMLDSQIKTHHWIGTPDPTLFIQDAKNPDRYWNIPIFHMTGNFSK
FIERGAKRIESNYGSKNTVSNVSFLNPDQSIVTVIINQTSADQKFHVVSENRQFEAVIPA
KTVATYKWK
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atgtttttgaaaaaaggtctgcacatgacgctggtttttcttatgtttttctttttcata
tcaagcagcatggaaaccgaagtgtatgcggctgatcggaaggcttcagacaaaaacaaa
gtaagggtgtggttcagttctgaaaaagatccggcttcccgtacgtggtatgacgggccg
ctagaagtgaaatacgccttagacgaacaaacaccgcttgcattgacaaaaaagaaggct
tctgactccgccgctgtgtatattgatccgtcgcgccgctatcaaagtgtgttaggtgta
ggatcgtccctggaagaatccacaatccataatttatcaaaaatgacacccgcaaaaaga
aaagaagtgctgaaaaaactggttgatcccaaagatggtatcggaatggacgttatgcgc
ataacgatcgggacatctgattttacggcacaggaattttatacgtatgacgatatgcct
gaaggccaaacagatcctaagctccatcatttctcgattcaaaaggatattgatttacac
attacagcaaccatcaaggaagcgctggcgataaatccggaactgaaaatcattgcctca
ccgtggagtccgccggcttggatgaaaacgaatgaaaacctcaagcggggaaagctgaaa
gataaatatatcggcgcactggccgtttacttccgcaaatttattgaggcgtacgaaaag
cagggaattccgatttatgcgatgacccttcaaaatgaacctttgctggaaatcgactat
ccaagcatgtatatgccgccgtctcagcagcgtaaactggcactggccttaaaaaaagaa
atgaaaaaacatgtaattgacacgaaaatttggatttatgatcacaatgcgagcggggcg
tggaactatattccgccgattttagatgataaaaaaggaaaccgggcggcagacggcatc
gcttttcacgattatgacggtgacctttccgtcatgtcagaaatcggaaagagatatcct
gataaatctattcacttaacggagcggtctgtctgggggacggcaggggcggaccggatc
gcgcagtatttccgcaatggcgcgtcgagctacaatgcgtgggtgacgatgctcgacagt
caaatcaagacgcatcattggataggcaccccagacccaacgctgtttattcaggatgct
aaaaaccctgaccgctattggaatatcccgatctttcatatgacaggcaacttttcaaaa
tttatcgaacggggagcaaagcggatagaaagtaattacggctccaaaaacacagtctcg
aatgtatcgttccttaatcctgatcaatccattgtgacagtcataatcaaccagacatcc
gccgatcaaaaattccatgtcgtttcagaaaatcggcagtttgaagctgtcatcccggct
aaaaccgtggctacctacaaatggaagtga

DBGET integrated database retrieval system