KEGG   Bacillus amyloliquefaciens CC178: U471_32060Help
Entry
U471_32060        CDS       T02893                                 

Definition
alpha/beta hydrolase family protein
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
bamc  Bacillus amyloliquefaciens CC178
Brite
Enzymes [BR:bamc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     U471_32060
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3204401..3205141)
Genome map
AA seq 246 aa AA seqDB search
MKIVTPKPFTFKGGDKAVLLLHGFTGNTADVRMLGRYLNERGYTCHAPQYKGHGVPPEEL
VHTGPEDWWKDVMDGYEYLRSEGYENIAACGLSLGGVFSLKLGYTVPIKGIVPMCAPMHI
KSEEVMYEGVLSYARNYKKFEGKQPEQIEKEMKEFEKTPMNTLKSLQELIADVRKNVDMI
YSPTFVVQARHDHMINTESANIIYNEVETDDKQLKWYEESGHVITLDKERDLVHQDVYEF
LEKLDW
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattgtgacaccaaaaccatttacatttaaaggcggagacaaagcggtgcttctg
ctgcacggatttacgggaaatacggcagacgtcagaatgctcggccgctacttgaatgag
cgcggctacacttgtcacgcgcctcaatataaagggcacggcgttccgccggaagaactg
gtacatacggggcctgaagattggtggaaagacgtcatggacggttatgaatatttacgg
tctgaaggctatgaaaacattgcggcctgcggactgtcgcttggcggggttttttcattg
aaattgggttacactgtacccataaagggaattgttcctatgtgtgcgccgatgcacatt
aaaagtgaagaggttatgtacgaaggagttctttcctacgcgcgcaattataaaaaattc
gaaggaaaacagccggagcagattgaaaaggaaatgaaggagtttgaaaaaacaccgatg
aatacgctcaaatcgcttcaggagctgattgccgatgtgcgcaaaaacgtcgacatgatc
tattccccgacatttgtggttcaggcacggcatgaccatatgattaatacagaaagtgcg
aacatcatttataacgaggtggaaacggacgacaaacagctgaaatggtatgaagaatca
ggccatgtcattacgctcgataaagaacgggacctcgttcatcaggatgtgtacgaattt
ttagagaaactcgattggtaa

DBGET integrated database retrieval system