KEGG   Bacillus amyloliquefaciens CC178: U471_34430Help
Entry
U471_34430        CDS       T02893                                 

Definition
hypothetical protein
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
bamc  Bacillus amyloliquefaciens CC178
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:bamc00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    U471_34430
Enzymes [BR:bamc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     U471_34430
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3431441..3432289
Genome map
AA seq 282 aa AA seqDB search
MDLVVTSERRPKAGETVLGTDFQTVPGGKGANQAVAASRLGANVYMVGKAGNDSYGKAII
ENLKANGVNTDHMETVTHKKSGTAHIVLAEGDNSIVVVKGANDDISPDYAKSALAKLPGI
DIVLIQQEIPEETVEEVCSYCRAQQIPVILNPAPARPLKQSTIEDAAYLTPNEHEASILF
PDRTKEEALAGYPGKLFITEGKQGVRYSDGTAERLIPAFPAEAVDTTGAGDTFNAALAVA
LAEGRDIEQALLFANRAASLSVQHFGAQGGMPARKEVEELLS
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atggatctggtcgtcacatctgaacggcgtccgaaagccggtgaaaccgtactgggcaca
gactttcaaaccgtgcccggaggaaaaggcgcaaatcaggccgtagccgcttcccgcctg
ggcgcaaacgtatatatggtaggaaaagcaggcaatgacagctacggaaaagcgattatt
gaaaacctgaaggcaaacggtgtcaatacggaccatatggaaacggttacacataaaaaa
agcggaacggctcatattgtgctcgcagaaggagacaacagcatcgtcgtcgtaaaaggc
gcaaacgatgacatctcccccgattatgccaaaagtgcgctagcaaaacttcccggcatt
gatatcgtgctgatccagcaggagattcctgaagaaaccgttgaagaagtgtgcagctac
tgccgcgcgcagcaaattccggttatcctgaatcccgcgccggcccggccgctgaaacaa
tcgacgattgaggatgccgcatatcttacgccgaacgaacatgaagcgtccattttattt
cctgaccggacgaaagaagaagcgctcgccggctatcccggcaaactgttcattaccgaa
ggaaaacaaggcgtgcgctactcagacggcaccgccgaacggcttattcccgccttccct
gcagaagcggtcgacacgacaggagccggcgatacctttaatgcagcacttgccgtcgca
ctcgcggaagggcgggacattgagcaagcgctcctgtttgccaaccgcgccgcctccctg
tccgtgcagcacttcggcgcccaaggcggcatgccggccagaaaagaagttgaggagctg
ctgtcatga

DBGET integrated database retrieval system