KEGG   Bacillus amyloliquefaciens LFB112: U722_01510Help
Entry
U722_01510        CDS       T02965                                 

Definition
alkaline phosphatase
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
bamf  Bacillus amyloliquefaciens LFB112
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:bamf00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    U722_01510
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    U722_01510
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    U722_01510
Enzymes [BR:bamf01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     U722_01510
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
291820..293571
Genome map
AA seq 583 aa AA seqDB search
MTHDGRLDEWIKELENKSFQNNTFDRRAFIQGAGKIAGLSLGLAIAQSIGAFEVNAAPKF
SNYPFTLGVASGDPLSDSVILWTRLAPDPLNGGGMPKQAVPVKWEIAADEHFRHIVKRGT
EMAKPNLGHSVHVEADGLKPNKVYYYRFKSGHELSPVGRTKTLPAPGADVSAMTFAFASC
QQYEHGYYTAYKHMAKEKLDLVFHLGDYIYEYGPNEYVSKTGNVRTHSSAEVYTLSDYRN
RHAQYRSDANLKAAHAAFPWVVTWDDHEVENNYANVIPEKGQSVEAFVLRRAAAYQAYYE
HMPLRRMSLPNGPDMRLYRQFSYGNLASFNVLDTRQYRDDQANGDGNKPPSDEWRDPKRT
LMGTEQEQWLFGNLAASKAKWNVLAQQIFFAQWNFGTTANPIYSMDSWDGYPAQRERVIN
FIKSKNLNNVIVLTGDVHASWASNLHTDFNQTNSKIFGAEFVGTSITSGGNGADKRADTD
QILKQNPHIKFFNDYRGYVRCTVTPAQWRADYRVVPYVTEPGAEVSTRASFIYQKDQTGI
RKVSQAAVAGGLKQSNEVEEDRFFAHNNAHEKQMRKKRAKISQ
NT seq 1752 nt NT seq  +upstreamnt  +downstreamnt
atgacacatgacggccgtttagatgaatggatcaaggaattggagaacaaaagctttcag
aacaatacgtttgaccgccgcgcatttatacagggcgccgggaaaatcgccggtctttcc
ctcgggttagcgatcgcgcaatccatcggcgcgtttgaagtgaatgccgctccgaaattt
tcaaactatccgttcaccctcggcgtagcttccggcgacccgctgtctgacagcgtcatt
ctctggacgcgtcttgcccctgacccgctgaatgggggcggcatgccgaagcaggccgtg
ccggtaaaatgggaaatcgccgcagatgaacatttccgtcacatcgtcaaacgcggaacg
gaaatggccaagccgaatctcggacactctgtccatgtcgaggcggacgggctcaagccc
aataaagtatactattaccggtttaaaagcgggcatgagctcagtcccgtcggccggacg
aaaacgctgcccgctcccggcgctgacgtatcggccatgacgtttgcatttgcctcatgc
cagcagtatgaacacggctattatacggcgtataaacatatggcgaaggaaaagcttgat
ctcgtattccatctcggagattacatttatgaatacggaccgaacgaatatgtgtcaaaa
acgggaaatgtcaggacgcacagcagcgccgaagtgtacacactgtcagattaccgcaac
cgtcacgcccaataccgctctgatgccaatctgaaagccgcccacgccgcatttccgtgg
gtcgtgacgtgggacgatcatgaggtggaaaacaattatgccaatgttatccctgaaaaa
ggccaatccgttgaagcgtttgtgctcaggagggccgcagcttatcaggcttattatgaa
cacatgccgctcaggcgcatgtcattgccgaacggtcctgatatgcggctgtacaggcaa
ttttcttatggcaatttagcatcgttcaatgtgcttgatacaagacagtacagagatgat
caggccaacggcgacgggaataagccgccttctgatgagtggagagacccgaagcgcaca
ttgatggggacagagcaggagcaatggctcttcggaaatttagccgcctcaaaagcgaag
tggaatgtgctggcgcagcaaatctttttcgcgcaatggaatttcggaacaaccgccaat
ccgatatacagcatggattcatgggacggctacccggctcagcgggagcgggtcatcaat
tttataaaaagcaaaaacctgaacaatgttatcgtgctgacgggtgatgttcatgcaagc
tgggcgtcaaacctgcataccgattttaatcaaacgaattcaaaaattttcggggccgaa
ttcgtcgggacctccattacatctggaggaaacggggcggataaacgggccgatacggat
cagatcttaaaacaaaacccgcatattaagtttttcaacgattaccgcggctatgtccgc
tgtacggtgactcctgcccaatggagagcggattacagagtggtgccgtacgtgacggag
ccgggggctgaggtatccacgcgggcttcattcatttatcagaaagaccagacggggatt
cggaaggtctctcaagcggcggttgcaggcggtttaaagcagtcaaacgaggtggaagag
gatcgtttcttcgcccataacaatgcgcatgaaaagcaaatgagaaagaaacgggccaaa
atctcacaataa

DBGET integrated database retrieval system