KEGG   Bacillus amyloliquefaciens LFB112: U722_01690Help
Entry
U722_01690        CDS       T02965                                 

Definition
alpha-amylase
Orthology
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
bamf  Bacillus amyloliquefaciens LFB112
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bamf00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    U722_01690
Enzymes [BR:bamf01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     U722_01690
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
329053..331032
Genome map
AA seq 659 aa AA seqDB search
MFEKRFKTSLLPLFAGFLLLFHLVLSGPAAANAETANKSNEVAASSVKNGTILHAWNWSF
NTLTQNMKEIRDAGYAAIQTSPINQVKEGNQGDKSMRNWYWLYQPTSYQIGNRYLGTEQE
FKDMCAAAEKYGVKVIVDAVINHTTSDYAAISDEIKRIPNWTHGNTQIKNWSDRWDVTQN
SLLGLYDWNTQNTEVQTYLKRFLERALNDGADGFRYDAAKHIELPDDGNYGSRFWPNITN
TSAEFQYGEILQDSASRDTAYANYMNVTASNYGHSIRSALKNRNLSVSNISHYASDVSAD
KLVTWVESHDTYANDEEESTWMSDDDIRLGWAVIGSRSGSTPLFFSRPEGGGNGVRFPGK
SQIGDRGSALFKDQTITAVNQFHNVMAGQPEELSNPNGNNQILMNQRGSKGVVLANAGSS
SVTVNTSTKLPDGRYDNRAGAGSFQVANGKLTGTINARSAAVLYSDDIGNAPQVFLENYQ
TGAVHSFNDQLTVTLRANAKTTKAVYQINNGQQTAFKDGDRLTIGKGDPIGTTYNIKLTG
TNGEGAARTQEYTFVKKDPAQTNIIGYQNPDHWGQVNAYIYKHDGGGAIELTGSWPGKAM
TKNANGIYTLTLPANADTANAKVIFNNGSAQVPGQNQPGFDYVQNGLYNNSGLNGYLPH
NT seq 1980 nt NT seq  +upstreamnt  +downstreamnt
atgtttgaaaaacgattcaaaacctctttactgccgttattcgccggatttttattgctg
tttcatttggttttgtcaggcccggcggctgcaaacgctgaaactgcaaacaaatcgaat
gaggtggccgcgtcatcggtcaaaaacgggaccatccttcatgcctggaattggtcgttc
aatacgttaacacaaaatatgaaagagattcgtgatgcgggctatgcagccattcagacg
tctccgattaaccaagtaaaggaagggaaccaaggagataaaagcatgaggaactggtac
tggctgtatcagccgacatcgtaccaaatcggcaaccgttacttaggcactgaacaagaa
tttaaggacatgtgtgcagccgcggaaaaatatggcgtaaaagtcattgttgatgcggtt
atcaatcataccaccagcgattacgccgcgatttctgacgagattaagcgtattccaaac
tggacccatggaaacacacaaattaaaaattggtcggacaggtgggacgtcactcaaaat
tcattgcttgggctgtatgattggaatacacagaatactgaggtgcaaacctatctgaaa
cgtttcttggaaagagcattgaatgacggagcggacgggttccgctatgatgccgccaag
catatagagcttccggatgatgggaattacggcagccgattttggccgaatatcacaaat
acatcggcggagttccaatacggagaaatcctgcaagacagcgcgtccagagatactgct
tatgcgaattatatgaatgtgacggcttctaactatgggcattccatcagatccgcttta
aagaaccgtaatctgagtgtgtcgaatatctcccattatgcatctgacgtgtctgcggac
aagttggtcacatgggtggaatcacatgatacgtatgccaatgatgaggaagagtccaca
tggatgagtgatgacgatattcgtttaggctgggcagtgattggttcccgctcaggaagc
acgcctcttttcttttccagacctgagggcggaggaaatggtgtaagatttcctggaaaa
agtcaaataggagatcgcgggagcgccttatttaaagatcagacgatcactgcggtcaat
caatttcacaatgtaatggccgggcagcctgaggaactctcgaatccgaatgggaacaat
caaatattgatgaatcagcgcggctcaaaaggcgttgtgctggctaatgcgggatcgtct
tctgtcaccgtcaatacttcaacgaaattgcctgacggcaggtatgataatagggccggc
gccggttcatttcaagtagcgaacggcaaactgacaggtacgatcaatgccagatccgcg
gctgttctttattctgatgatattggaaatgcgcctcaggtctttcttgagaattaccaa
acgggggcagtccattctttcaatgatcagctgacggtcaccctgcgtgcaaatgcgaaa
acaacaaaagccgtttaccaaatcaataatgggcagcagacagcatttaaggatggagac
cgattaacgatcgggaaaggagatccaatcggcacgacatacaacatcaagttaaccgga
acgaacggcgagggtgcagcgagaacccaagaatacacgtttgtcaaaaaagacccggcc
caaaccaacatcattggctatcaaaatccggatcattggggccaggtaaatgcttatatt
tacaaacatgatggaggcggggccatagaattaaccggatcgtggccggggaaagcaatg
actaagaatgcaaatggaatttacacgctgacgctgcctgcgaatgcggatacggccaat
gccaaagtgatttttaacaatggcagcgcccaagtgcccgggcagaaccagcccggattt
gattatgtgcagaatggtttgtataacaactccggtttaaacggttatcttccgcattaa

DBGET integrated database retrieval system