KEGG   Bacillus amyloliquefaciens LFB112: U722_02105Help
Entry
U722_02105        CDS       T02965                                 

Definition
4-aminobutyrate aminotransferase
Orthology
K07250  
4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
bamf  Bacillus amyloliquefaciens LFB112
Pathway
Alanine, aspartate and glutamate metabolism
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:bamf00640]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:bamf00650]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:bamf00250]
Metabolism; Amino acid metabolism; Valine, leucine and isoleucine degradation [PATH:bamf00280]
Metabolism; Metabolism of other amino acids; beta-Alanine metabolism [PATH:bamf00410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
431100..432407
Genome map
AA seq 435 aa AA seqDB search
MSRTASSEVTTAQWQQKRDQFVSKGVGNGNRSMAVKGEGALLYDLDGRRFIDFAGAIGTL
NVGHSHPKVVEAVKKQAEDLIHPGFNVMMYPSYIELAEKLCALAPGDHAKKAIFLNSGAE
AVENAVKIARKYTKRQAVVSFTRGFHGRTNMTMSMTSKVKPYKYGFGPFASEVYQAPFPY
YYQKPAGMSDEQYDDFIISAFEDFFIAAVAPETVACVVMEPVQGEGGFIIPSKRFVQHVA
AFCKKHGIVFVADEIQTGFARTGTYFAIEHFEAVPDLITVSKSLAAGLPLSGVIGRAEML
DAAAPGELGGTYAGSPLGCAAALAVLDIIEEEGLNQRSEEIGRIIERQALEWKKEHACIG
EVRRLGAMAAIEIVKDPHTREPDKAKAAAIAKTANENGLLLLTAGINGNIIRFLTPLVVT
DEQLKEGLSIIEAAL
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgagtcgaacagcatcatcggaagtgacaactgcccagtggcagcaaaaacgggatcaa
ttcgtttccaagggggtcggcaacggaaaccgcagcatggcggtaaaaggggaaggggcg
cttttgtacgatttggacggcagacgattcattgattttgccggagcgatcggaacgctg
aatgtcggccattctcatccgaaagtggtggaggccgtgaagaaacaggcggaggatctg
attcacccgggatttaacgtcatgatgtatccgtcttatattgagctggccgaaaaactt
tgcgcccttgcgccgggagatcatgcgaaaaaagcgatttttctcaattcgggggcggaa
gcggtggaaaacgccgtgaaaatcgccagaaaatatacgaagcgccaggctgtcgtgtca
tttacaagagggttccacggccgcacgaacatgacgatgagcatgacgagcaaggtgaag
ccttataaatacggtttcggcccgtttgcctcagaggtgtatcaagcgccgtttccttac
tattatcaaaagccggccggcatgagcgacgagcagtatgacgactttatcatcagcgct
ttcgaggatttctttatcgccgcagtcgcaccggaaaccgtcgcctgtgtcgtaatggag
ccggttcagggagaaggcggcttcatcattccgtcaaaacgtttcgtgcagcacgtcgcc
gctttttgtaaaaaacacggtatcgtttttgtagcggatgagattcagaccggttttgcc
agaacgggaacgtattttgcgattgagcatttcgaagccgttccggatttgatcaccgta
tccaaatcacttgcggccggattacctctgagcggtgtcatcggccgggcggaaatgctt
gatgccgccgcgccgggggaactcggtggcacatatgcgggaagcccgctcggctgtgcg
gctgcgctcgcggtcctggatattattgaagaagaagggctgaatcagcgttccgaagag
atcggccggatcatcgagcgtcaagcgctcgagtggaaaaaagagcatgcctgcatcgga
gaagtgcgcagactcggcgcgatggcggccatcgaaattgtcaaagatccgcacacgcgg
gaaccggataaagcaaaagccgcggcgatcgctaaaacggcgaacgagaacggactgctg
ctgctgacggccggcattaacggcaacattatccgattcctgacgccgcttgtcgtgacg
gatgagcagctcaaagaaggcctttccattatcgaagcagctctgtga

DBGET integrated database retrieval system