KEGG   Bacillus amyloliquefaciens LFB112: U722_03680Help
Entry
U722_03680        CDS       T02965                                 

Definition
NADPH--cytochrome P450 reductase
Orthology
K14338  
cytochrome P450 / NADPH-cytochrome P450 reductase [EC:1.14.14.1 1.6.2.4]
Organism
bamf  Bacillus amyloliquefaciens LFB112
Pathway
Fatty acid degradation
Tryptophan metabolism
Aminobenzoate degradation
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bamf00001]
 Metabolism
  Lipid metabolism
   00071 Fatty acid degradation
    U722_03680
  Amino acid metabolism
   00380 Tryptophan metabolism
    U722_03680
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    U722_03680
Enzymes [BR:bamf01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     U722_03680
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     U722_03680
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
717303..720485
Genome map
AA seq 1060 aa AA seqDB search
MKETGPIPQPKTFGPLGNLPLLDKDKPTMSLIKLANEQGPIFQLHTPAGAIIVVSGHELV
KEVCDEERFDKSIEGALEKVRAFAGDGLFTSWTHEPNWRKAHNILMPTFSQRAMKDYHSM
MTDIAVQLIQKWARLNPDEAVDVPADMTRLTLDTIGLCGFNYRFNSYYRETPHPFINSMV
RALDEAMHQMQRLDVQDKLMIRTKRQFHHDIQAMFSLVDSIIAERRSGGRDEKDLLARML
NVEDPETGEKLDDENIRFQIITFLIAGHETTSGLLSFAIYFLLKHPRVLEKAYEEADRVL
TDPVPSYKQVLELSYIRMILQESLRLWPTAPAFSLYAKEDTVIGGKYPITPKDRISVLIP
QLHRDKDAWGDNAEEFYPERFEHPDQVPHHAYKPFGNGQRACIGMQFALHEATLVLGMIL
QHFTFIDHTDYELDIKQTLTIKPGDFHIRVRPRNKGAVAAALPAAEKAAEDVEKEKRETK
GASIIGLDNRPLLILYGSDTGTAEGVARELADTAGMHGVRTETAPLNDRIGKLPKEGALL
IITSSYNGKPPSNAGQFVQWLEEVKPGELEGVRYAVFGCGDHNWAATYQAVPRLIDEKLA
EKGAERFSARGEGDVSGDFEGKLDEWKKSMWTDAMKAFGLKLNENAEKERSALGLQFVSG
LGGSPLAQTYEAVYASVAENRELQAPESGRSTRHIEITLPKEAAYHEGDHLGVLPVNSKE
QVSRVLRRFNLNGNDQVLLTASGQSAAHLPLDRPVRLHDLLSSCVELQEAASRAQIREMA
AYTVCPPHKRELEDFLEEGVYQEQILTSRVSMLDLLEKYEACELPFERFLELLRPLKPRY
YSISSSPRKHPGQASITVGVVRGPARSGLGEYRGVASNYLADRRPEDGIVMFVRTPETRF
RLPEDPEKPIIMVGPGTGVAPFRGFLQARAALKKEGKELGEAHLYFGCRNDHDFIYRDEL
EAYEKDGIVTLHTAFSRKEGVPKTYVQHLMAKDAGALISILGRGGHLYVCGDGSKMAPDV
EATLQKAYQSVRETDERQAQEWLLDLQTKGIYAKDVWAGI
NT seq 3183 nt NT seq  +upstreamnt  +downstreamnt
atgaaggaaacaggtccgattccgcagccgaagacattcggtcctctcggcaatcttcct
ttgcttgataaagacaagcctacaatgtcgctgatcaaactggcaaacgagcaggggcct
atttttcagctgcataccccggcgggcgccattatcgtcgtgtccggacatgaactggtg
aaagaggtatgtgatgaagagcggttcgataaaagcattgaaggtgctttggagaaagtc
cgggcgtttgccggtgacgggctgtttacaagctggacgcatgagcctaactggcgaaag
gcgcataatattctgatgccgaccttcagccagcgcgcgatgaaagattatcattcgatg
atgactgatatcgcggtgcagctgattcaaaaatgggctaggctgaacccggatgaggcc
gttgatgtgcctgctgatatgacccgcctgacgctcgatacgatcgggctttgcggcttt
aactatcggtttaacagctattacagggaaacgcctcatccgtttatcaacagcatggtg
cgcgcccttgatgaagcgatgcaccaaatgcagcgccttgatgttcaggataagctcatg
atcaggacgaagcgccaatttcatcatgacattcaggcgatgttttcgttagtagacagt
attatcgcagagcgccggtcaggcggacgggatgaaaaggatctgctggccagaatgctg
aatgtggaagacccggaaacgggcgaaaaacttgatgatgaaaatatccggtttcaaatc
atcacgtttttaattgccggccacgaaacgaccagcggcctgctttcctttgccatctat
tttctgctgaaacatccccgtgttttggaaaaagcctatgaagaagccgatcgggttttg
accgatcccgttccttcttataaacaagtactggagcttagttatatccgaatgattttg
caggagtcattgcgcttatggccgaccgcgcctgcgttcagcctttatgcgaaagaggat
acggtgatcggcgggaaatatccgatcacgccgaaagacagaatttccgtcttaattccc
cagcttcaccgtgataaagacgcgtggggagacaatgcggaggaattttatccggagcgg
tttgaacatcctgatcaagtgcctcaccatgcgtataagcctttcggaaacgggcagagg
gcgtgtatcggtatgcagttcgccctgcatgaagcaactcttgttctggggatgattctg
cagcattttacctttatcgatcacaccgattatgagctcgatattaaacagacactgacg
attaagcccggcgactttcatatccgggtgcggccgagaaacaaaggagccgttgcggca
gctctcccggcggctgaaaaagcggcggaagacgtcgaaaaagaaaaacgggaaacaaaa
ggcgcatccattatcgggcttgataaccgaccgcttctgattttgtacggctcagatacg
ggaaccgcagaaggcgtggcgcgggagcttgccgatactgccgggatgcacggcgtccgg
actgaaacggcgcctttaaatgaccggatcggaaaactgccgaaagaaggagctctcttg
atcattacgtcctcttataacggaaagcctccgagcaacgcgggacaattcgttcaatgg
cttgaagaagtcaaacccggggagctggaaggtgtccgatatgccgtcttcggctgcggt
gatcataactgggcggcgacatatcaggctgtgccgagactgattgatgagaagcttgcc
gaaaaaggggcggaacgcttttctgcccgaggcgaaggggacgtcagcggcgattttgaa
ggaaagcttgatgaatggaaaaaaagcatgtggacggacgccatgaaggcattcggtctc
aagctgaatgaaaatgccgaaaaagagcgaagtgcgctgggccttcaatttgtcagcggg
cttggcgggtctccgttggcacagacgtatgaagcggtttacgcatccgttgcggaaaac
agggaacttcaggcgccggaaagcggccggagcacaaggcatatcgaaatcactctgccg
aaagaggctgcctatcatgaaggggatcatctcggcgtgctgccggtaaacagcaaagag
caggtcagccgtgttctccgccggttcaatctgaacgggaatgatcaagtgctgctgacg
gccagcggacagagcgcggctcatctcccgctcgatcggccggtcaggctgcatgatctt
ctgagcagctgtgtcgaattgcaggaagcggcatcaagggctcaaatccgggaaatggcc
gcttatacggtctgtccgccgcacaaacgggaattggaagattttcttgaggagggcgtc
tatcaggagcaaatcttaacatcgcgcgtctcaatgctcgatctccttgaaaaatatgaa
gcgtgtgaacttccgtttgagcgatttctggagcttttgcgcccgctgaagccgcggtat
tattcgatttcaagttcgcctcggaaacatcccgggcaggcttcaattaccgtcggtgtc
gttcgaggccccgcccggagcggtttgggtgagtatcgcggagtcgcttcgaattattta
gcggaccgccgccctgaggatggtatcgtgatgtttgtccgcactccggaaacacgattc
cggctgccggaagatccggaaaaaccgattattatggtcggtcccggcacaggagtcgcc
ccgttccgcggatttctgcaggctcgggcagcgttaaaaaaagaaggaaaagagctgggg
gaggctcatctgtatttcggatgcagaaacgatcatgattttatttaccgtgacgagctt
gaagcttatgaaaaagacggaatcgtgacgcttcatacggctttctcccgcaaagaaggc
gtaccgaaaacatatgtgcagcacttaatggcgaaagacgccggcgctttaatttccatc
ctcggccggggagggcacctctacgtatgcggcgacggcagcaaaatggcgcccgatgta
gaggcaacgctgcaaaaagcgtatcagtcggtccgcgaaacagacgaacggcaagcgcaa
gaatggcttttggacctccagacaaaaggcatttacgcaaaagatgtttgggcggggatt
tga

  All links  
No link information was found.   
DBGET integrated database retrieval system