KEGG   Bacillus amyloliquefaciens LFB112: U722_03680Help
Entry
U722_03680        CDS       T02965                                 

Definition
NADPH--cytochrome P450 reductase
Orthology
K14338  
cytochrome P450 / NADPH-cytochrome P450 reductase [EC:1.14.14.1 1.6.2.4]
Organism
bamf  Bacillus amyloliquefaciens LFB112
Pathway
Fatty acid degradation
Tryptophan metabolism
Aminobenzoate degradation
Microbial metabolism in diverse environments
Class
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:bamf00071]
Metabolism; Amino acid metabolism; Tryptophan metabolism [PATH:bamf00380]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:bamf00627]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
717303..720485
Genome map
AA seq 1060 aa AA seqDB search
MKETGPIPQPKTFGPLGNLPLLDKDKPTMSLIKLANEQGPIFQLHTPAGAIIVVSGHELV
KEVCDEERFDKSIEGALEKVRAFAGDGLFTSWTHEPNWRKAHNILMPTFSQRAMKDYHSM
MTDIAVQLIQKWARLNPDEAVDVPADMTRLTLDTIGLCGFNYRFNSYYRETPHPFINSMV
RALDEAMHQMQRLDVQDKLMIRTKRQFHHDIQAMFSLVDSIIAERRSGGRDEKDLLARML
NVEDPETGEKLDDENIRFQIITFLIAGHETTSGLLSFAIYFLLKHPRVLEKAYEEADRVL
TDPVPSYKQVLELSYIRMILQESLRLWPTAPAFSLYAKEDTVIGGKYPITPKDRISVLIP
QLHRDKDAWGDNAEEFYPERFEHPDQVPHHAYKPFGNGQRACIGMQFALHEATLVLGMIL
QHFTFIDHTDYELDIKQTLTIKPGDFHIRVRPRNKGAVAAALPAAEKAAEDVEKEKRETK
GASIIGLDNRPLLILYGSDTGTAEGVARELADTAGMHGVRTETAPLNDRIGKLPKEGALL
IITSSYNGKPPSNAGQFVQWLEEVKPGELEGVRYAVFGCGDHNWAATYQAVPRLIDEKLA
EKGAERFSARGEGDVSGDFEGKLDEWKKSMWTDAMKAFGLKLNENAEKERSALGLQFVSG
LGGSPLAQTYEAVYASVAENRELQAPESGRSTRHIEITLPKEAAYHEGDHLGVLPVNSKE
QVSRVLRRFNLNGNDQVLLTASGQSAAHLPLDRPVRLHDLLSSCVELQEAASRAQIREMA
AYTVCPPHKRELEDFLEEGVYQEQILTSRVSMLDLLEKYEACELPFERFLELLRPLKPRY
YSISSSPRKHPGQASITVGVVRGPARSGLGEYRGVASNYLADRRPEDGIVMFVRTPETRF
RLPEDPEKPIIMVGPGTGVAPFRGFLQARAALKKEGKELGEAHLYFGCRNDHDFIYRDEL
EAYEKDGIVTLHTAFSRKEGVPKTYVQHLMAKDAGALISILGRGGHLYVCGDGSKMAPDV
EATLQKAYQSVRETDERQAQEWLLDLQTKGIYAKDVWAGI
NT seq 3183 nt NT seq  +upstreamnt  +downstreamnt
atgaaggaaacaggtccgattccgcagccgaagacattcggtcctctcggcaatcttcct
ttgcttgataaagacaagcctacaatgtcgctgatcaaactggcaaacgagcaggggcct
atttttcagctgcataccccggcgggcgccattatcgtcgtgtccggacatgaactggtg
aaagaggtatgtgatgaagagcggttcgataaaagcattgaaggtgctttggagaaagtc
cgggcgtttgccggtgacgggctgtttacaagctggacgcatgagcctaactggcgaaag
gcgcataatattctgatgccgaccttcagccagcgcgcgatgaaagattatcattcgatg
atgactgatatcgcggtgcagctgattcaaaaatgggctaggctgaacccggatgaggcc
gttgatgtgcctgctgatatgacccgcctgacgctcgatacgatcgggctttgcggcttt
aactatcggtttaacagctattacagggaaacgcctcatccgtttatcaacagcatggtg
cgcgcccttgatgaagcgatgcaccaaatgcagcgccttgatgttcaggataagctcatg
atcaggacgaagcgccaatttcatcatgacattcaggcgatgttttcgttagtagacagt
attatcgcagagcgccggtcaggcggacgggatgaaaaggatctgctggccagaatgctg
aatgtggaagacccggaaacgggcgaaaaacttgatgatgaaaatatccggtttcaaatc
atcacgtttttaattgccggccacgaaacgaccagcggcctgctttcctttgccatctat
tttctgctgaaacatccccgtgttttggaaaaagcctatgaagaagccgatcgggttttg
accgatcccgttccttcttataaacaagtactggagcttagttatatccgaatgattttg
caggagtcattgcgcttatggccgaccgcgcctgcgttcagcctttatgcgaaagaggat
acggtgatcggcgggaaatatccgatcacgccgaaagacagaatttccgtcttaattccc
cagcttcaccgtgataaagacgcgtggggagacaatgcggaggaattttatccggagcgg
tttgaacatcctgatcaagtgcctcaccatgcgtataagcctttcggaaacgggcagagg
gcgtgtatcggtatgcagttcgccctgcatgaagcaactcttgttctggggatgattctg
cagcattttacctttatcgatcacaccgattatgagctcgatattaaacagacactgacg
attaagcccggcgactttcatatccgggtgcggccgagaaacaaaggagccgttgcggca
gctctcccggcggctgaaaaagcggcggaagacgtcgaaaaagaaaaacgggaaacaaaa
ggcgcatccattatcgggcttgataaccgaccgcttctgattttgtacggctcagatacg
ggaaccgcagaaggcgtggcgcgggagcttgccgatactgccgggatgcacggcgtccgg
actgaaacggcgcctttaaatgaccggatcggaaaactgccgaaagaaggagctctcttg
atcattacgtcctcttataacggaaagcctccgagcaacgcgggacaattcgttcaatgg
cttgaagaagtcaaacccggggagctggaaggtgtccgatatgccgtcttcggctgcggt
gatcataactgggcggcgacatatcaggctgtgccgagactgattgatgagaagcttgcc
gaaaaaggggcggaacgcttttctgcccgaggcgaaggggacgtcagcggcgattttgaa
ggaaagcttgatgaatggaaaaaaagcatgtggacggacgccatgaaggcattcggtctc
aagctgaatgaaaatgccgaaaaagagcgaagtgcgctgggccttcaatttgtcagcggg
cttggcgggtctccgttggcacagacgtatgaagcggtttacgcatccgttgcggaaaac
agggaacttcaggcgccggaaagcggccggagcacaaggcatatcgaaatcactctgccg
aaagaggctgcctatcatgaaggggatcatctcggcgtgctgccggtaaacagcaaagag
caggtcagccgtgttctccgccggttcaatctgaacgggaatgatcaagtgctgctgacg
gccagcggacagagcgcggctcatctcccgctcgatcggccggtcaggctgcatgatctt
ctgagcagctgtgtcgaattgcaggaagcggcatcaagggctcaaatccgggaaatggcc
gcttatacggtctgtccgccgcacaaacgggaattggaagattttcttgaggagggcgtc
tatcaggagcaaatcttaacatcgcgcgtctcaatgctcgatctccttgaaaaatatgaa
gcgtgtgaacttccgtttgagcgatttctggagcttttgcgcccgctgaagccgcggtat
tattcgatttcaagttcgcctcggaaacatcccgggcaggcttcaattaccgtcggtgtc
gttcgaggccccgcccggagcggtttgggtgagtatcgcggagtcgcttcgaattattta
gcggaccgccgccctgaggatggtatcgtgatgtttgtccgcactccggaaacacgattc
cggctgccggaagatccggaaaaaccgattattatggtcggtcccggcacaggagtcgcc
ccgttccgcggatttctgcaggctcgggcagcgttaaaaaaagaaggaaaagagctgggg
gaggctcatctgtatttcggatgcagaaacgatcatgattttatttaccgtgacgagctt
gaagcttatgaaaaagacggaatcgtgacgcttcatacggctttctcccgcaaagaaggc
gtaccgaaaacatatgtgcagcacttaatggcgaaagacgccggcgctttaatttccatc
ctcggccggggagggcacctctacgtatgcggcgacggcagcaaaatggcgcccgatgta
gaggcaacgctgcaaaaagcgtatcagtcggtccgcgaaacagacgaacggcaagcgcaa
gaatggcttttggacctccagacaaaaggcatttacgcaaaagatgtttgggcggggatt
tga

DBGET integrated database retrieval system