KEGG   Bacillus amyloliquefaciens LFB112: U722_10555Help
Entry
U722_10555        CDS       T02965                                 

Definition
glucosylceramidase
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
bamf  Bacillus amyloliquefaciens LFB112
Pathway
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bamf00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    U722_10555
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    U722_10555
Enzymes [BR:bamf01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     U722_10555
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2130287..2131765)
Genome map
AA seq 492 aa AA seqDB search
MFFKKSLHMTLVFLVFFFFISSSTEAEVYAADRKASDKNKVRVWFSSEKDPASRTWYDGP
LEVKYALDEQTPLTWTKKKASDSAAVYIDPSRRYQSVLGVGSSLEESTIHNLSKMTPAKR
KEVLKKLVDPKDGIGMDVMRITIGTSDFTAQEFYTYDDMPEGQTDPKLRHFSIQKDIDLH
ITATIKEALAINPELKIIASPWSPPAWMKTNENLKRGKLKDKYIGALAVYFRKFIEAYEK
QGIPIYAMTLQNEPLLEIDYPSMYMPPSQQRKLAIAVKKELKKHIIDTKIWIYDHNASGA
WNYIPPILDDKKGNRAADGIAFHDYDGDLSVMSEIGKRYPDQSIHLTERSVWGTAGADRI
AQYFRNGASSYNAWVTMLDSQIKTHHWIGTPDPTLFIQDAKNPDRYWNIPIFHMTGNFSK
FIERGAKRIESNYGSKNTVSNVSFLNPDQSIVTVVINQTSSEQKFHVVSENRQFEAVIPA
KTVATYKWQHKK
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atgttttttaaaaaaagtctgcacatgaccctggtttttcttgtgtttttctttttcata
tcaagcagcacggaagccgaagtgtatgcggctgatcggaaggcttcagacaaaaacaaa
gtaagggtgtggttcagttctgaaaaagatccggcttcccgtacgtggtatgacgggccg
ctggaagtgaaatacgccttagacgaacaaacaccgcttacatggacaaaaaagaaggct
tctgactccgccgccgtgtatattgatccgtcgcgccgctatcaaagtgtgttgggcgta
ggatcgtccctggaagaatccacaatccataatttatcaaaaatgacacccgcaaaaaga
aaagaagtgctgaaaaaactggttgatcccaaagatggtatcggcatggacgttatgcgc
ataacgatcgggacatctgattttacggcacaggaattttatacgtatgacgatatgcct
gaaggccaaacagatcctaagctccgtcatttctcgatccaaaaggatattgatttacac
attacagcaaccatcaaggaagcgctggcgataaatccggaactgaaaatcattgcctca
ccgtggagcccgccggcttggatgaaaacgaatgaaaacctcaagcggggaaagctgaaa
gataaatatatcggcgcactggccgtttacttccgcaaatttattgaggcgtacgaaaag
cagggaattccgatttatgcgatgacccttcaaaatgaacctttgctggaaatcgactat
ccgagcatgtacatgccgccgtctcagcagcgcaaactggcgatagccgtgaaaaaagaa
ttgaaaaaacacataattgacacgaaaatttggatttatgatcacaatgcgagcggggcg
tggaactatattccgccgattttagatgataaaaaaggaaaccgggcggcagacggcatc
gcttttcacgattatgacggtgacctttccgtcatgtcggaaatcggaaagagatatcct
gatcaatctattcacttaacggagcggtctgtctgggggacggcaggggcggatcggatc
gcacagtatttccgcaacggcgcgtcgagctacaatgcgtgggtgacgatgctcgacagt
caaatcaagacgcatcattggataggcaccccggacccgacgctgtttattcaggatgct
aaaaaccctgaccgctattggaatatcccgatctttcatatgacaggcaacttttcaaaa
tttatcgagcgcggagccaaacggatagaaagtaattacggctccaaaaacacagtctcg
aatgtatcgttccttaatcctgatcaatccattgtgacagtcgtaatcaaccagacatct
tcagaacaaaaattccatgtcgtttcagaaaatcggcagtttgaagccgtcatcccggct
aaaaccgtcgccacctacaaatggcagcacaaaaagtaa

DBGET integrated database retrieval system