KEGG   Bacillus amyloliquefaciens LFB112: U722_13165Help
Entry
U722_13165        CDS       T02965                                 

Definition
NADPH--cytochrome P450 reductase
Orthology
K14338  
cytochrome P450 / NADPH-cytochrome P450 reductase [EC:1.14.14.1 1.6.2.4]
Organism
bamf  Bacillus amyloliquefaciens LFB112
Pathway
Fatty acid degradation
Tryptophan metabolism
Aminobenzoate degradation
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bamf00001]
 Metabolism
  Lipid metabolism
   00071 Fatty acid degradation
    U722_13165
  Amino acid metabolism
   00380 Tryptophan metabolism
    U722_13165
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    U722_13165
Enzymes [BR:bamf01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     U722_13165
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     U722_13165
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2619239..2622400)
Genome map
AA seq 1053 aa AA seqDB search
MKQLSAIPQPKTYGPLKNLPHLEKEKLSQSLWKIAEEYGPIFRFEFPSSVGVFVSGRELA
AEVCDEKRFDKNLSKALLKVREFGGDGLFTSWTHEKNWQKAHRILLPSFSQKAMKGYHSM
MLDIAMQLVQKWSRLNPNEEIDVAEDMTRLTLDTIGLCGFHYRFNSFYRDTQHPFITSML
RALQEAMRQSQRHSLQDKLMIKTRHQFQQDIEVMNELVDRIIAERRENPDENLSDLLALM
LEAKDPVTGERLDDENIRYQIITFLIAGHETTSGLLSFAIYCLLKNKDKLKKAVQEAERV
LTGETPEYKQIQQLTYIRMVLNETLRLYPTAPAFSLYAKEDTVLGGKYPIAKGQPVTILT
PQLHRDKSAWGEDAELFRPERFSDPAAIPADAYKPFGNGQRACIGMQFALQEATMVLGLV
LKHFELIDHTDYELTIKEALTIKPGDFKIRVKNKDVSNHQPVQNHKAEGGGHKEETKEIP
SHGTPLLILYGSNLGTAEGIAEELADIGRSKGFSTETGPLDDYAGKLPVKGAVVIVTASY
NGAPPDNAVGFVKWTETLEDQELKGVSYAVFGCGDRNWAATYQRIPRLIDKVLEEKGAKR
LTSIGEGDNADDFEYSQEAWEDSFWKDIMKAFHIEAAPKQANKSQLSIEYVSEAAETPIA
KTYKAFEAEVITNKELHTESSKRSVRHIELRLPKTETYREGDHLGVLPQNSGELISRVIR
RFGLDPNQHFKIKGRQLPHLPMDRPVNAPELLASYVELQEPATRAQLRELAAHTVCPPHQ
KELEHLYSDDAAYKENVLKKRMTMLDLLEDYPACELPFERFLELLPSLKARYYSISSSPK
ANKRELSITVGVVTAPAWSGRGEYKGVASNYLAGLQNGDSAVCFIRSPQSGFALPENTKT
PLIMIGAGTGIAPFRGFIQARAAEKMSGNSLGEAHLYFGCRHPEEDDLYKDEFDHAEKNG
LVTVHRAYSRLDQDCKVYVQDVLLREAAQIIALLDQGGHLYICGDGSKMAPAVENVLLQA
YEKVHNTDSKVSSNWLEQLQAEGRYAKDVWAGV
NT seq 3162 nt NT seq  +upstreamnt  +downstreamnt
atgaaacagctaagcgctataccgcagccgaaaacatacggacctctgaaaaatctccct
cacttggaaaaagaaaaactgtcacaatcgctctggaaaattgccgaagaatacggcccg
atctttcgtttcgaatttccgagctctgtcggggtcttcgtctcaggccgcgagctcgcg
gcagaagtctgtgatgaaaagcgatttgataaaaacctcagcaaagccttgctgaaagtc
cgtgagtttggcggtgacggactatttacgagctggactcacgaaaagaattggcagaaa
gcgcatcggattttattgccgagcttcagccagaaggcgatgaaaggctatcattcaatg
atgcttgatattgccatgcagctcgtgcagaagtggagcagattaaatccgaatgaagaa
attgacgttgccgaagatatgacgcgcctgacgctggatacaatcggcctgtgcggattt
cattaccgctttaacagcttttaccgcgacacacagcatccttttatcacaagtatgctt
cgcgcgctgcaggaggcaatgcgccaatcgcagagacacagcctgcaggacaagctgatg
atcaaaacgagacatcagttccagcaggatattgaagtgatgaatgaactcgtagaccgg
atcatagctgagcggagggaaaatccggatgagaatctgtctgaccttttagcattgatg
cttgaagcgaaagatcctgtaacgggtgaaaggctggatgatgaaaatatccgttatcaa
atcattacctttttgatcgcggggcatgaaaccacaagcggactgctttcattcgcgatt
tactgcctgctgaaaaataaagataaattgaaaaaagccgttcaggaagccgagcgggtg
ctgacgggagagacacctgaatataagcagattcagcagctgacatatatccgcatggtg
ttaaacgagactttgcggctgtatccgactgccccggcattttccctgtacgcgaaagaa
gatacggttctcggcgggaaatatccgattgcgaaaggacagccggtgacgattctgact
ccgcagcttcaccgggataaaagcgcgtggggagaagatgccgagctattccgtccggaa
aggttcagcgatcccgcggcaattccggctgatgcgtataagccgttcggaaacggacag
cgcgcatgcatcgggatgcagtttgccctgcaggaagcgacaatggtgctcggccttgtc
cttaaacactttgaactgattgatcatactgattatgagcttacgattaaagaagcttta
accattaagcccggtgattttaaaatccgtgtaaaaaacaaggacgtgtccaatcatcag
cccgtacaaaaccataaagctgaaggcggcggtcacaaagaagaaacgaaagaaatcccg
tcccacggaacgccgcttctcattctttacggttcaaatttgggaactgcggaaggaatc
gcggaagagctggctgacatcggcagaagcaaaggattttcaactgaaaccggcccgctt
gatgattatgccgggaaactgcctgtaaaaggcgcagtcgttattgtgacggcttcttat
aacggggcgccgcctgataatgcggtgggttttgtgaaatggacggaaacccttgaggat
caggaattaaagggtgtttcttacgccgtcttcggctgcggagaccgcaactgggccgcc
acttaccagagaatcccccgcctgatagacaaagtgcttgaagaaaaaggggcaaaacgg
ctgacttctatcggggagggcgacaatgccgatgattttgagtacagtcaggaagcctgg
gaagactcattctggaaggacatcatgaaggcttttcatatagaggccgctccaaaacag
gcaaacaaatcacagttatcaatcgaatacgtaagtgaagcagccgagacgccgattgcc
aaaacgtacaaagcatttgaggcggaagtcatcacaaacaaagagcttcataccgaaagc
agcaagcgttcagtccggcatattgagctgcgtctcccgaagaccgaaacgtatcgggaa
ggagaccatctcggggtgcttccgcaaaacagcggggaactgatcagccgtgtcattcgc
cgattcggtctcgacccaaatcagcactttaagatcaagggccggcagctgcctcatctg
ccgatggaccggccggttaatgcgcctgagcttttggcgtcatatgtagagctgcaggaa
ccggcaacgagagcccagcttcgcgaacttgccgcccataccgtgtgcccgccgcaccaa
aaagaattggagcatctttattctgacgatgcggcatataaagaaaacgtgctgaaaaaa
cgaatgaccatgctggacctgctggaagattatccggcttgtgaactgccgtttgagcgc
tttttagaacttctgccgtccttaaaggcgcgctattattcaatctcaagctcaccgaag
gcaaacaaaagggagctcagtatcacggtcggcgttgtgacggctccggcgtggagcggc
cggggagaatacaagggcgtggcttcgaactatttagccggattacaaaatggcgattct
gccgtctgtttcatccgctcgccgcagtcgggtttcgcattgcccgaaaatacgaaaacg
cctctcattatgatcggagcaggcaccggaattgcaccgttcaggggatttatccaggcg
cgggctgcagaaaaaatgtccggtaacagcctgggcgaagctcatttatacttcggctgc
agacaccctgaagaagacgatctgtacaaagatgaattcgaccatgcggagaaaaacggc
cttgtcaccgtgcatcgggcgtattccagattagatcaggactgtaaagtttacgtacag
gatgtcctgcttcgcgaggctgcacagattattgcgcttcttgaccaaggcggccatctc
tatatatgcggagacggaagcaaaatggctccggctgtcgaaaatgtactgcttcaggcg
tatgaaaaggtgcataacactgattcaaaggtttcctcgaattggcttgaacagctgcag
gcggaaggaagatatgcgaaagatgtttgggcaggtgtgtaa

DBGET integrated database retrieval system