KEGG   Bacillus amyloliquefaciens LFB112: U722_16605Help
Entry
U722_16605        CDS       T02965                                 

Definition
carboxylesterase
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
bamf  Bacillus amyloliquefaciens LFB112
Brite
Enzymes [BR:bamf01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     U722_16605
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3261634..3262374)
Genome map
AA seq 246 aa AA seqDB search
MKIVTPKPFTFKGGDKAVLLLHGFTGNTADVRMLGRYLNERGYTCHAPQYKGHGVPPEEL
VHTGPEDWWKDVMDGYEYLRSEGYENIAACGLSLGGVFSLKLGYTVPIKGIVPMCAPMHI
KSEEVMYEGVLSYARNYKKFEGKQPEQIEKEMKEFEKTPMNTLKSLQALIADVRKNVDMI
YSPTFVVQARHDHMINTESANIIFNEVETDDKQLKWYEESGHVITLDKERDLVHQDVYEF
LEKLDW
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattgtgacaccaaaaccatttacatttaaaggcggagacaaagcggtgcttctg
ctgcacggatttacgggaaatacggcagacgtcagaatgctcggccgctacttgaatgag
cgcggctacacttgtcacgcgcctcaatataaagggcacggcgttccgccggaagagctg
gtacatacgggacctgaagattggtggaaagacgtcatggacggttatgagtatttacgg
tctgaaggatatgaaaacattgcggcgtgcggactgtcgcttggcggggttttttcattg
aaattgggttacactgtacccataaagggaattgttcctatgtgtgcgccgatgcacatt
aaaagtgaagaggttatgtacgaaggagttctctcctacgcgcgcaattataaaaaattc
gaaggaaaacagccggagcagattgaaaaggaaatgaaggagtttgaaaaaacgccgatg
aatacgctcaaatcgctccaggcgctgattgccgatgtgcgcaaaaacgtcgacatgatc
tattccccgacatttgtggttcaggcacggcatgaccatatgattaatacagaaagtgcg
aacatcattttcaacgaggtggaaacggacgacaaacagctgaaatggtatgaagaatca
ggccatgtcattacactcgataaagaacgggacctcgttcatcaggatgtgtacgaattt
ttagagaaactcgattggtaa

DBGET integrated database retrieval system