KEGG   Bacillus amyloliquefaciens IT-45: KSO_000460Help
Entry
KSO_000460        CDS       T02462                                 

Definition
(GenBank) arginase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
bami  Bacillus amyloliquefaciens IT-45
Pathway
bami00220  Arginine biosynthesis
bami00330  Arginine and proline metabolism
bami01100  Metabolic pathways
bami01110  Biosynthesis of secondary metabolites
bami01130  Biosynthesis of antibiotics
bami01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bami00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    KSO_000460
   00330 Arginine and proline metabolism
    KSO_000460
Enzymes [BR:bami01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     KSO_000460
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: AGF25601
Position
85701..86591
Genome map
AA seq 296 aa AA seqDB search
MNKNISVIGMPMDLGQARRGVDMGPSAIRYAHLIERLSDMGYAVEDLGDIPVNREKLKHD
EELKNLNSVLSGNEQLAQKVDSVIENERFPLVLGGDHSIAIGTLTGTAKHYKQLGVIWYD
AHGDLNTLETSPSGNIHGMPLAVSLGVGHDTLVNLGGYAPKIKPENVVIIGARSLDEGER
EYIKETGMKVYTMHEIDRLGMTKVIEETIDYLSDCDGVHLSLDLDGLDPSDAPGVGTPVV
GGISYRESHLAMEMLYDADIITSAEFVEVNPILDHKNKTGKTAVELVESLLGKKLL
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgaacaagaatatctcagttattggaatgccgatggatttaggacaagcacgacgcgga
gtggacatgggcccgagcgccatccgctacgcgcatctcattgaacggttatctgacatg
gggtatgcggtggaagacttaggcgacatccccgtcaatcgtgaaaaactcaaacatgat
gaagagctgaaaaatttgaactctgtgctctcggggaacgagcagctcgcccaaaaggtg
gacagcgtcattgagaatgagcggttccctctcgtcttgggcggcgatcacagcatcgcg
atcggaacgctgacaggaacggcaaagcactataaacagctcggcgtcatctggtacgac
gcgcacggcgacttaaacaccctggaaacatcgccgtcaggcaatattcacggaatgccg
ctggccgtcagcctcggcgtcgggcacgacacgctggtgaatctgggcgggtatgccccg
aaaatcaagccggagaacgtcgtcatcatcggcgcgagatcgcttgatgaaggcgagcgt
gaatacattaaggaaacaggcatgaaagtctatacgatgcatgagattgaccgcctcggc
atgacaaaggtcattgaagaaaccattgactacctgtcagactgtgacggcgttcacctc
agccttgatctagacggccttgatccgagcgacgcacccggcgtaggcacgcctgtcgtc
ggcggcatcagctaccgtgaaagccatttggcaatggaaatgctgtatgatgccgacatc
atcacttcagctgaatttgtcgaagtcaacccgatcctcgatcacaaaaacaaaaccggc
aaaacagcggtcgagctggtggaatctttgttgggaaaaaaactattataa

DBGET integrated database retrieval system