KEGG   Bacillus amyloliquefaciens IT-45: KSO_001920Help
Entry
KSO_001920        CDS       T02462                                 

Definition
thymidine kinase (EC:2.7.1.21)
Orthology
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
bami  Bacillus amyloliquefaciens IT-45
Pathway
Pyrimidine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:bami00240]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
365495..366085
Genome map
AA seq 196 aa AA seqDB search
MYIMKQSGWLELVCGSMFSGKSEELIRRVKRATYAKQEVKVFKPAIDNRYSEEAVVSHNG
TSITSHVISSSAEIWDHISENTDVIAVDEVQFFGESIIGDLSLLADKGYRVIAAGLDMDF
RGEPFGVVPNLMAVAESVTKLQAVCSVCGSPASRTQRLIDGKPASYDDPVILVGASESYE
ARCRHHHEVPKKQTDK
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgtacataatgaagcaaagcggatggcttgagctggtatgcggcagcatgttctctggg
aaatcagaagagctgatccgcagagtgaaaagagcgacatatgcgaagcaggaggtcaag
gtgttcaaacctgccattgataatcgctacagtgaggaggctgtcgtttctcacaacggc
acatccatcacaagccacgtcatctcgtcttcggctgaaatatgggatcatatcagtgaa
aacacggacgtcatcgcggtagatgaagtgcagtttttcggcgaatcgatcatcggcgac
ttatccttgcttgcggataaaggctatcgtgtcatcgcggccggacttgatatggatttc
cggggagagccgttcggtgtggtgccgaatctgatggcggttgccgaatcagtgacgaag
ctgcaggcggtctgctccgtttgcgggtcgccggcaagccgtacgcagcgtttgattgac
gggaagcccgcttcctatgatgatccggtcattttagtcggcgcgtcggagtcatacgaa
gcgagatgcagacatcaccacgaagtgccgaaaaaacagactgataaataa

DBGET integrated database retrieval system