KEGG   Bacillus amyloliquefaciens IT-45: KSO_005440Help
Entry
KSO_005440        CDS       T02462                                 

Definition
alpha-galactosidase
Orthology
K07406  
alpha-galactosidase [EC:3.2.1.22]
Organism
bami  Bacillus amyloliquefaciens IT-45
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:bami00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:bami00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:bami00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1038922..1040220)
Genome map
AA seq 432 aa AA seqDB search
MKKITFIGAGSTIFAKNVLGDCLLTEALNGFEFALYDIDAVRLKESQLMLENMRDRYNPS
ISIISYDDRKQALTHAGYVINAIQVGGYKPATVIDFDIPKRYGLRQTIADTVGIGGIFRS
LRTIPVLFDIAKDMEEVCPDAWLLNYTNPMASLTGAMLRHTNVKTVGLCHSVQVCTKDLF
DSLGMDHEGTEERIAGINHMAWLLEIKKDGIDLYPEIKRRAREKQKTKHKDMVRFELMDK
FGCYVTESSEHNAEYHPYFIKSRYPELIDELQIPLDEYPRRCAEQIKNWETMRDGIINNQ
NLTHERSKEYGSRIIEAMETGRPFTFGGNVLNTGLIPNLPAKAVVEVPCAAVKNQIMPCY
SGELPEQLAALNRTNINTQLLTIEAAVTLKKEAVYQAAMLDPHTSAELSMNDIISLCDDL
FEAHKDRLPAYH
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
ttgaagaaaattacgtttatcggagcggggagcacgattttcgcaaaaaatgtactgggg
gactgtttactgactgaagcattaaacggatttgaattcgcgctttatgatattgacgct
gtacggctgaaagaatctcagctcatgctggaaaacatgagagaccgctacaatccgagt
atatccatcatctcctacgatgaccgaaaacaggcgcttacacacgccggctatgtgata
aacgccattcaggtcggaggctataaacccgcgacggtcattgactttgacatcccgaag
cggtacggtctccgccagacgattgccgataccgtcggaataggcggcattttccgttcc
ctccgcaccatccccgttttatttgacattgcaaaagacatggaagaggtctgcccggat
gcgtggctgttaaactatacaaatccgatggcctctctgaccggagcgatgctcagacat
acaaatgtcaaaacggtcggcctgtgccacagcgtccaggtctgtaccaaagatctgttc
gactcactcggcatggatcacgaaggtacggaagaacgcattgccggcatcaaccatatg
gcttggcttttggagattaaaaaagacggaattgatttatatccggaaattaaaagacgg
gcacgcgaaaaacaaaagacgaaacataaggacatggtgcggtttgagctgatggataaa
ttcggctgctacgtgacggaatcatctgagcataatgccgaatatcacccgtattttata
aaaagccggtatccggagctgatagatgaactccaaattccgcttgatgaatatccgagg
agatgcgcggaacaaatcaaaaactgggaaacgatgagagacgggatcatcaacaaccaa
aacctgacgcatgaacgctcgaaagaatacggttcgagaattatagaagcgatggagacg
ggccgtccgttcacattcggcggcaatgtgctgaataccgggctgataccgaatctgccg
gcgaaagcggtcgttgaagtgccgtgcgccgccgttaaaaaccaaattatgccgtgctat
tccggcgaacttccggagcagctcgcggcgctcaacagaacaaacatcaacacacagctt
ttaaccatcgaagcggccgttacattaaaaaaggaagccgtatatcaagcggccatgctt
gatccgcatacgagcgccgagctttccatgaatgacatcatctctttgtgcgatgactta
tttgaagcgcacaaagaccggcttccggcttatcactga

DBGET integrated database retrieval system