KEGG   Bacillus amyloliquefaciens IT-45: KSO_007250Help
Entry
KSO_007250        CDS       T02462                                 

Definition
NADPH-ferrihemoprotein reductase
Orthology
K14338  
cytochrome P450 / NADPH-cytochrome P450 reductase [EC:1.14.14.1 1.6.2.4]
Organism
bami  Bacillus amyloliquefaciens IT-45
Pathway
Fatty acid degradation
Tryptophan metabolism
Aminobenzoate degradation
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bami00001]
 Metabolism
  Lipid metabolism
   00071 Fatty acid degradation
    KSO_007250
  Amino acid metabolism
   00380 Tryptophan metabolism
    KSO_007250
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    KSO_007250
Enzymes [BR:bami01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     KSO_007250
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     KSO_007250
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1377253..1380414
Genome map
AA seq 1053 aa AA seqDB search
MKQLSAIPQPKTYGPLKNLPHLEKEKLSQSLWKIAEEYGPIFRFEFPSSVGVFVSGRELA
AEVCDEKRFDKNLSKALLKVREFGGDGLFTSWTHEKNWQKAHRILLPSFSQKAMKGYHSM
MLDIAMQLVQKWSRLNPNEEIDVAEDMTRLTLDTIGLCGFHYRFNSFYRDTQHPFITSML
RALQEAMRQSQRHSLQDKLMIKTRHQFQQDIEVMNELVDRIIAERRENPDENLSDLLALM
LEAKDPVTGERLDDENIRYQIITFLIAGHETTSGLLSFAIYCLLKNKDKLKKAVQEAERV
LTGETPEYKQIQQLIYIRMVLNETLRLYPTAPAFSLYAKEDTVLGGKYPIAKGQPVTILT
PQLHRDKSAWGEDAELFRPERFSDPAAIPADAYKPFGNGQRACIGMQFALQEATMVLGLV
LKHFELIDHTDYELTIKEALTIKPGDFKIRVKNKDVSNHQPVQNHKAEGGGHKEETKEIP
SHGTPLLILYGSNLGTAEGIAEELADIGRSKGFSTETGPLDDYAGKLPVKGAVVIVTASY
NGAPPDNAAGFVKWMETLEDQELKGVSYAVFGCGDRNWAATYQRIPRLIDKVLEEKGAKR
LTSIGEGDNADDFEYSQEAWEDSFWKDIMKAFHIEAAPKQANKSQLSIEYVSEAAETPIA
KTYKAFEAEVITNKELHTESSKRSVRHIELRLPKTETYQEGDHLGVLPQNSGELISRVIR
RFGLDPNQHFKIKGRQLPHLPMDRPVNAPELLASYVELQEPATRAQLRELAAHTVCPPHQ
KELEHLYSDDAAYKENVLKKRMTMLDLLEDYPACELPFERFLELLPSLKARYYSISSSPK
ANKRELSITVGVVTAPAWSGRGEYRGVASNYLAGLQNGDSAVCFIRSPQSGFALPENTKT
PLIMIGAGTGIAPFRGFIQARAAEKMSGNSLGEAHLYFGCRHPEEDDLYKDEFDHAEKNG
LVTVHRAYSRLDQDCKVYVQDVLLREAAQIIALLDQGGHLYICGDGSKMAPAVENVLLQA
YEKVHNTDSKVSSNWLEQLQAEGRYAKDVWAGV
NT seq 3162 nt NT seq  +upstreamnt  +downstreamnt
atgaaacagctaagcgctataccgcagccgaaaacatacggacctctgaaaaatctccct
cacttggaaaaagaaaaactgtcacaatcgctctggaaaattgccgaagaatacggcccg
atctttcgtttcgaatttccgagctctgtcggggtcttcgtctcaggccgcgagctcgcg
gcagaagtctgtgatgaaaagcgatttgataaaaacctcagcaaagccttgctgaaagtc
cgtgagtttggcggtgacggactatttacgagctggactcacgaaaagaattggcagaaa
gcgcatcggattttattgccgagcttcagccagaaggcgatgaaaggctatcattcaatg
atgcttgatattgccatgcaactcgtgcagaagtggagcagattaaatccgaatgaagaa
attgacgttgccgaagatatgacgcgcctgacgctggatacaatcggcctgtgcggattt
cattaccgctttaacagcttttaccgcgacacacagcatccttttatcacaagtatgctt
cgcgcgctgcaggaggcaatgcgccaatcgcagagacacagcctgcaggacaagctgatg
atcaaaacgagacatcagttccagcaggatattgaagtgatgaatgaactcgtagaccgg
atcatcgctgagcggagggaaaatccggatgagaatctgtctgaccttttagcattgatg
cttgaagcgaaagatcctgtaacgggtgaaaggctggatgatgaaaatatccgttatcaa
atcattacctttttgatcgcggggcatgaaaccacaagcggactgctttcattcgcgatt
tactgcctgctgaaaaataaagataaattgaaaaaagccgttcaggaagccgagcgggtg
ctgacgggagagacacctgaatataagcagattcagcagctgatatatatccgcatggtg
ttaaacgagactttgcggctgtatccgactgccccggcattttccctgtacgcgaaagaa
gatacggttctcggcgggaaatatccgattgcgaaaggacagccggtgacgattctgact
ccgcagcttcaccgggataaaagcgcgtggggagaagatgccgagctattccgtccggaa
aggttcagcgatcccgcggcaattccggctgatgcgtataagccgttcggaaacggacag
cgcgcatgcatcgggatgcagtttgccctgcaggaagcgacaatggtgctcggccttgtc
cttaaacactttgaactgattgatcatactgattatgagcttacgattaaagaagcttta
accattaagcccggtgattttaaaatccgtgtaaaaaacaaggacgtgtccaatcatcag
cccgtacaaaaccataaagctgaaggcggcggtcacaaagaagaaacgaaagaaatcccg
tcccacggaacgccgcttctcattctttacggttcaaatttgggaactgcggaaggaatc
gcggaagagctggctgacatcggcagaagcaaaggattttcaactgaaaccggcccgctt
gatgattatgccgggaaactgcctgtaaaaggcgcagtcgttattgtgacggcttcttat
aacggggcgccgcctgataatgcggcgggttttgtgaaatggatggaaacccttgaagat
caggaattaaagggtgtttcttatgctgtcttcggctgcggagaccgcaactgggccgcc
acttaccagaggatcccccgcctgatagacaaagtgcttgaagaaaaaggggcaaaacgg
ctgacttctatcggggagggcgacaatgccgatgattttgagtacagtcaggaagcctgg
gaagactcattctggaaggacatcatgaaggcttttcatatagaggccgctccaaaacag
gcaaacaaatcacagttatcaatcgaatacgtaagtgaagcagccgagacgccgattgcc
aaaacgtacaaagcatttgaggcggaagtcatcacaaacaaagagcttcataccgaaagc
agcaagcgttcagtccggcatattgaactgcgtctcccgaaaaccgaaacgtatcaggaa
ggagaccatctcggggtgcttccgcaaaacagcggggaactgatcagccgtgtcattcgc
cgattcggtcttgatccgaaccagcactttaagatcaagggccggcagctgcctcatctg
ccgatggaccggccggttaatgcgccggagcttttggcgtcatatgtagagctgcaggaa
ccggcaacgagagcccagcttcgcgaacttgccgcccataccgtgtgcccgccgcaccaa
aaagaattggagcatctttattctgacgatgcggcatataaagaaaacgtgctgaaaaaa
cgaatgaccatgctggacctgctggaagattatccggcttgtgaactgccgtttgagcgt
tttttagaacttctgccgtccttaaaggcgcgctattattcaatctcaagctcaccgaag
gcaaacaaaagggagctcagtatcacggtcggcgttgtgacggctccggcgtggagcggc
cggggagaatacaggggcgtggcttcgaactatttagccggattacaaaatggcgattct
gcggtctgtttcatccgctcgccgcagtcgggttttgcattgcctgaaaatacgaaaacg
cctctcattatgatcggagcaggcaccggaattgcaccgttcaggggatttatccaggcg
cgggctgcagaaaaaatgtccggtaacagcctgggcgaagctcatttatacttcggctgc
agacaccctgaagaagacgatctgtacaaagatgaattcgaccatgcggagaaaaacggc
cttgtcaccgtgcatcgggcgtattccagattagatcaggactgtaaagtttacgtacag
gatgtcctgcttcgcgaggctgcacagattattgcgcttcttgaccaaggcggccatctc
tatatatgcggagacggaagcaaaatggctccggctgtcgaaaatgtactgcttcaggcg
tatgaaaaggtgcataacactgattcaaaagtttcctcgaattggcttgaacagctgcag
gcggaaggaagatatgcgaaagatgtttgggcaggtgtgtaa

DBGET integrated database retrieval system