KEGG   Bacillus amyloliquefaciens IT-45: KSO_008170Help
Entry
KSO_008170        CDS       T02462                                 

Definition
(GenBank) acetyl-CoA C-acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bami  Bacillus amyloliquefaciens IT-45
Pathway
bami00071  Fatty acid degradation
bami00072  Synthesis and degradation of ketone bodies
bami00280  Valine, leucine and isoleucine degradation
bami00310  Lysine degradation
bami00362  Benzoate degradation
bami00380  Tryptophan metabolism
bami00620  Pyruvate metabolism
bami00630  Glyoxylate and dicarboxylate metabolism
bami00640  Propanoate metabolism
bami00650  Butanoate metabolism
bami00900  Terpenoid backbone biosynthesis
bami01100  Metabolic pathways
bami01110  Biosynthesis of secondary metabolites
bami01120  Microbial metabolism in diverse environments
bami01130  Biosynthesis of antibiotics
bami01200  Carbon metabolism
bami01212  Fatty acid metabolism
bami02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bami00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    KSO_008170
   00630 Glyoxylate and dicarboxylate metabolism
    KSO_008170
   00640 Propanoate metabolism
    KSO_008170
   00650 Butanoate metabolism
    KSO_008170
  Lipid metabolism
   00071 Fatty acid degradation
    KSO_008170
   00072 Synthesis and degradation of ketone bodies
    KSO_008170
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    KSO_008170
   00310 Lysine degradation
    KSO_008170
   00380 Tryptophan metabolism
    KSO_008170
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    KSO_008170
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    KSO_008170
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    KSO_008170
Enzymes [BR:bami01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     KSO_008170
Exosome [BR:bami04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   KSO_008170
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt DUF2656
Motif
Other DBs
NCBI-ProteinID: AGF27131
Position
1537369..1538550
Genome map
AA seq 393 aa AA seqDB search
MGKTVIVSAARTPFGKFGGALKEVKAAELGGIAIKEAIKRAAISESEAEGAVMGMVVQAG
AGQIPARQAARYAGLPWSVPAETINKVCASGLRAVTICDQMIRAKDADVMIAGGMESMSN
IPYAIPAGRWGVRMGDGVFQDLMVHDGLTCAFDQVHMAVHGSTAAKKYGISRDEQDHYAL
LSQKRAAEAAEAGKLREEIVPVTWTGKKGKQHIVEADEGLRPDTSLEQLAALKPIFTADG
TVTAGNAPGVNDGAGAFVLMSEEKAAKQHVRPLAAILGFASVGLEASELASAPGEAISRL
LKKTGLSVDDIDLFEVNEAFASVVLVSEKIAGFSQEKVNVNGGAIAFGHPIGASGARIVM
SLIYELKRRGGGVGIAAICSGAAQGDAVLLEVY
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
gtgggaaaaacggttatcgtcagtgcggcaagaacgccgttcggaaaattcggcggcgca
ttaaaagaggtaaaggcagccgagcttggcggcattgccataaaagaagcaatcaagcgc
gccgctatcagtgaaagcgaagcggaaggagcggtgatggggatggtcgtccaggcgggt
gccgggcagattccggcacggcaggctgcaagatatgccgggcttccatggtccgtgccg
gctgaaaccattaataaagtctgtgcatcagggctcagagccgttaccatctgtgatcaa
atgatccgggcgaaagacgcggacgtgatgattgcaggcggaatggaaagcatgagcaac
atcccgtacgccattccggccggccgctggggtgtgaggatgggggacggggtttttcag
gatttaatggttcatgacgggctgacctgtgcgttcgaccaggtgcatatggctgtccac
ggaagcactgcggccaaaaagtacggcatttcccgggatgaacaggatcattacgctctt
ttgagtcagaaacgcgcggctgaggcggctgaggcgggcaaattgcgtgaagaaattgtc
cccgtcacctggaccggcaaaaagggcaaacagcatatcgttgaagcggatgaggggctg
cgtcctgatacaagccttgagcagctcgcagcgctcaagccgattttcacagccgacgga
acggttacagccggaaacgctcccggtgtaaatgacggggccggagcatttgtgctgatg
tcagaggaaaaagcagcaaagcagcatgtcaggccgctcgcggcgatacttggctttgcg
tccgtcggactggaagcgtccgagctggcaagcgcgccgggagaggccatcagccggctc
ttgaaaaaaaccggactgtccgttgacgatattgatttgtttgaagtaaatgaagcattt
gcgtccgtcgtgctcgtgagtgaaaaaatagccgggttcagccaggagaaagtgaatgta
aacggaggggcaatcgcgttcggccacccgatcggcgcaagcggagcgagaatcgtcatg
agtttaatatacgaattaaagcgtcgcggagggggggtaggcatagcggctatatgcagc
ggagcggctcaaggagatgccgtcctgctggaggtgtactga

DBGET integrated database retrieval system