KEGG   Bacillus amyloliquefaciens IT-45: KSO_008950Help
Entry
KSO_008950        CDS       T02462                                 

Gene name
folE
Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
bami  Bacillus amyloliquefaciens IT-45
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:bami00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    KSO_008950 (folE)
Enzymes [BR:bami01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     KSO_008950 (folE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1729938..1730510
Genome map
AA seq 190 aa AA seqDB search
MKEVNKEQIEQAVRQILEAIGEDPDREGLLDTPKRVAKMYAEVFSGLNEDPKEHFKTVFG
EEHEELVLVKDIAFHSMCEHHLVPFYGKAHIAYIPRGGKVTGLSKLARAVEAVSKRPQLQ
ERITSTIAESIVETLDPHGVMVVVEAEHMCMTMRGVRKPGAKTVTSAVRGIFKDDAAARS
EVLEHIKRAD
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaagttaataaagaacagattgaacaggcggttcgccagattttagaggcgatt
ggagaagatccggaccgggaagggcttttagatacgccgaaacgcgtggcaaaaatgtac
gcggaagtattctcgggattaaatgaagacccgaaagaacactttaaaaccgttttcgga
gaagagcatgaggagcttgttcttgtaaaagatatcgcgtttcattccatgtgtgaacat
caccttgttcctttttacggaaaagcgcatattgcctacattccgcgcggcggcaaagtg
acgggcctgagtaaattggcgcgggcggtggaagccgtctcaaaacgcccgcagctgcag
gagcgcattacttcaacgattgcagaaagcatcgtagagaccttagatccccacggcgtc
atggttgtcgtcgaagctgagcatatgtgcatgacgatgaggggcgtaagaaagcctggc
gcaaaaacagtgacttccgctgtaagaggtatttttaaagatgacgcagcggcgcgttcc
gaagtgttagaacatattaaacgtgcggattaa

DBGET integrated database retrieval system