KEGG   Bacillus amyloliquefaciens IT-45: KSO_008950Help
Entry
KSO_008950        CDS       T02462                                 

Gene name
folE
Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
bami  Bacillus amyloliquefaciens IT-45
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:bami00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1729938..1730510
Genome map
AA seq 190 aa AA seqDB search
MKEVNKEQIEQAVRQILEAIGEDPDREGLLDTPKRVAKMYAEVFSGLNEDPKEHFKTVFG
EEHEELVLVKDIAFHSMCEHHLVPFYGKAHIAYIPRGGKVTGLSKLARAVEAVSKRPQLQ
ERITSTIAESIVETLDPHGVMVVVEAEHMCMTMRGVRKPGAKTVTSAVRGIFKDDAAARS
EVLEHIKRAD
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaagttaataaagaacagattgaacaggcggttcgccagattttagaggcgatt
ggagaagatccggaccgggaagggcttttagatacgccgaaacgcgtggcaaaaatgtac
gcggaagtattctcgggattaaatgaagacccgaaagaacactttaaaaccgttttcgga
gaagagcatgaggagcttgttcttgtaaaagatatcgcgtttcattccatgtgtgaacat
caccttgttcctttttacggaaaagcgcatattgcctacattccgcgcggcggcaaagtg
acgggcctgagtaaattggcgcgggcggtggaagccgtctcaaaacgcccgcagctgcag
gagcgcattacttcaacgattgcagaaagcatcgtagagaccttagatccccacggcgtc
atggttgtcgtcgaagctgagcatatgtgcatgacgatgaggggcgtaagaaagcctggc
gcaaaaacagtgacttccgctgtaagaggtatttttaaagatgacgcagcggcgcgttcc
gaagtgttagaacatattaaacgtgcggattaa

DBGET integrated database retrieval system