KEGG   Bacillus amyloliquefaciens IT-45: KSO_010315Help
Entry
KSO_010315        CDS       T02462                                 

Definition
glycoside hydrolase family protein
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
bami  Bacillus amyloliquefaciens IT-45
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bami00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    KSO_010315
Enzymes [BR:bami01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     KSO_010315
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2038069..2039568
Genome map
AA seq 499 aa AA seqDB search
MKRSISIFITCLLITVLTMGGLQASPASAAGTKTPVAKNGQLSIKGTQLVNRDGKAVQLK
GISSHGLQWYGDFVNKDSLKWLRDDWGITVFRAAMYTADGGYIDNPSVKNKVKEAVEAAK
ELGIYVIIDWHILNDGNPNQNKEKAKEFFKEMSSLYGNTPNVIYEIANEPNGDVNWKRDI
KPYAEEVISVIRKNDPDNIIIVGTGTWSQDVNDAADDQLKDANVMYALHFYAGTHGQSLR
DKANYALSKGAPIFVTEWGTSDASGNGGVFLDQSREWLNYLDSKNISWVNWNLSDKQESS
SALKPGASKTGGWPLTDLTASGTFVRENILGNKDSTKERPETPAQDNPAQENGISVQYKA
GDGGVNSNQIRPQLHIKNNGNATVDLKDVTARYWYNAKNKGQNFDCDYAQIGCGNLTHKF
VTLHKPKQGADTYLELGFKTGTLSPGASTGNIQLRLHNDDWSNYAQSGDYSFFQSNTFKT
TKKITLYHQGKQIWGTEPN
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgaaacggtcaatttctatttttattacgtgtttattgattacggtattgacaatgggc
ggcttgcaggcttcgccggcatctgcagcagggacaaaaacgccagtagccaagaatggg
cagcttagcataaaaggaacacagctcgtaaaccgggacggcaaagcggtacaattgaaa
gggatcagttcacatggattgcaatggtatggcgattttgtcaataaagacagcttaaaa
tggctgagagacgattggggcataaccgttttccgcgcggcgatgtataccgcagatggc
ggttatattgacaacccttccgtgaaaaataaagtaaaagaagcggttgaagcggcaaaa
gaacttgggatatatgtcatcattgactggcatatcttaaatgacggcaacccaaaccaa
aacaaagagaaggcaaaagaattttttaaggaaatgtcaagtctttacggaaacacgcca
aacgtcatttatgaaattgcaaacgaaccaaacggtgatgtgaactggaagcgggatatt
aaaccgtatgcggaagaagtgatttccgttatccgcaaaaatgatccagacaacatcatc
attgtcggaaccggtacatggagccaagatgtgaatgatgcagccgatgatcagctaaaa
gatgcaaacgtcatgtacgcgcttcatttttatgccggcacacacggccaatctttacgg
gataaagcaaactatgcactcagtaaaggagcgcctattttcgtgacggaatggggaaca
agcgacgcgtctggaaatggcggtgtattccttgaccagtcgcgggaatggctgaattat
ctcgacagcaagaacatcagctgggtgaactggaatctttctgataagcaggaatcatcc
tcagcgttaaagccgggagcatctaaaacaggcggctggccgcttacagatttaactgct
tcaggaacattcgtaagagaaaacattctcggcaacaaagattcaacgaaagaacgccct
gaaacgccagcacaagataaccccgcacaggaaaacggcatttctgtacaatacaaagca
ggggatgggggtgtgaacagcaaccaaatccgcccgcagcttcacataaaaaataacggc
aatgcgacggttgatttaaaagatgtcactgcccgttactggtataacgcgaaaaacaag
ggccaaaactttgactgtgactacgcgcagattggatgcggcaatctgacccacaaattt
gtgacgctgcataaacctaagcaaggtgcagatacctatctggaactgggttttaaaaca
ggaacgctgtcaccgggagcaagcacagggaatattcagcttcgtcttcacaatgatgac
tggagtaattatgcacaaagcggcgattattcctttttccaatcaaatacatttaaaaca
acgaaaaaaatcacattatatcatcaaggaaaacagatttggggaacagaacccaattag

DBGET integrated database retrieval system