KEGG   Bacillus amyloliquefaciens IT-45: KSO_012785Help
Entry
KSO_012785        CDS       T02462                                 

Gene name
ligD
Definition
ATP-dependent DNA ligase (EC:6.5.1.1)
Orthology
K01971  
bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
bami  Bacillus amyloliquefaciens IT-45
Pathway
Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:bami00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    KSO_012785 (ligD)
Enzymes [BR:bami01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     KSO_012785 (ligD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
2614552..2616387
Genome map
AA seq 611 aa AA seqDB search
MVLTMQPILTSVPPEGSEWRYEVKYDGFRCLLRIDENGVTLTSRNGQTLTNQFPEITAFA
ARCFQHMKDRFPITLDGELVYLINPYRADFEHLQIRGRLKRTEAIKSTAERRPCRFLAFD
LLVLEGAGTVSLPYVKRKRALSKLLKEANLPACPHHLAEEAIQYIPEHTDFDALWDKVVR
HDGEGIVAKRTSSGWAENKRSPDWQKYKHMKTAHVLLTGFNPKNGYVTASVLKDGIVVPI
ASVSHGMQAEEKNAVRTIMETHGKKQKSGEYTLEPSICMTVQYLTILQDTLREVSFVSFQ
FEMDWTECTYQQLILRSKTLPPKLQFTSLDKIVFKKREKTKADFLSYMVKMSDFLMPFLK
DRAVTVIRYPHGAPGESFFQKNKPDYTPDFVSSVFDGSHEHIVCSSIPSLLWLANQLALE
FHVPFQTVHSERPAEIVIDLDPPSRNDFPMAVEAAHVLKQLFDSFSMTSFPKLSGNKGIQ
LYIPLSPEAFTYEETRAFTMLIADYCVRTRPDLFTTERFIKNRNGRLYLDYLQHAEGKTI
IAPYSTRGNELGTVAAPLYWSEVNSSLTPDDYTIDTVVNRVRTEGDPFYDFYRNPQDGPL
SIVLEQIKRKS
NT seq 1836 nt NT seq  +upstreamnt  +downstreamnt
atggtgctgacgatgcagccgattttgacctctgtaccgcctgaaggcagtgagtggcgc
tatgaggtaaagtatgacggattccgctgtcttctccgcatagacgaaaacggtgttaca
ttaaccagcagaaacggacagacgctgacgaatcaatttccggaaatcacggcttttgcg
gcccggtgttttcagcacatgaaagacaggttccccattacgcttgacggagagcttgtc
tatttaatcaatccgtacagggcggactttgagcatcttcaaatccgcggacgtttaaaa
cgaaccgaagcaattaaaagcaccgctgagagacggccgtgccgctttctggcatttgat
ctcctcgttctggaaggcgccggcaccgtctcattaccgtatgtgaaacggaagcgcgcc
ctttccaaactgcttaaagaagcaaatcttcccgcctgccctcatcacttagcggaagaa
gcaattcaatacattccggagcacactgactttgacgcgctttgggacaaggtcgtccgc
catgacggagaaggtatcgtagccaaaaggacttccagcggatgggcggaaaataaacgc
tctcccgactggcagaagtataaacatatgaaaacggctcatgtgctattaaccggattc
aatccgaagaacgggtatgtgacagcctctgttttgaaagacggcatcgtcgtcccgatc
gcttccgtgtcccacggcatgcaggcggaagaaaaaaacgccgtcagaaccattatggag
acccacggaaaaaaacaaaaaagcggcgagtatacacttgagccttctatctgcatgacc
gtgcagtatttaaccatattgcaggacacgctgcgtgaagtatcttttgtgtcctttcag
tttgaaatggattggacggaatgcacgtatcagcagcttatcctccgctctaaaacgctg
ccgccgaagctgcagttcacaagcctggataagatcgtttttaaaaaacgtgaaaaaacg
aaagcagatttccttagttatatggtgaaaatgagcgattttcttatgccctttcttaaa
gatcgggccgtcacggtgatccgttatccgcacggcgcgcctggcgaatctttctttcaa
aaaaacaaaccggactacacgccggactttgtctcaagcgtgtttgacgggagccacgag
cacatcgtatgcagcagcataccgtcacttctatggctggctaatcagctggcgcttgaa
tttcacgttccgtttcagacagtgcattctgaaaggcccgcagaaatcgtcattgatctt
gatcctccgtcaaggaatgattttcctatggcagtggaggctgcgcatgtgctgaaacag
ctgtttgactcattcagcatgacgtcattcccgaagctctccggaaataaaggcattcag
ctttacatcccgctttcaccggaagcattcacctatgaagaaacccgtgctttcacaatg
ctcatcgccgattattgcgtcaggacacgcccggatctttttacgacagagcggtttatc
aaaaaccgaaacggcaggctctacctagattatttgcagcatgccgaagggaaaaccatt
atcgccccctattcgacccggggcaacgaattgggaacggttgcggctcccctttattgg
agcgaagtcaactcctctttaacacctgatgattatacgatcgatacagtagtgaaccgc
gtcaggacagagggagatccgttttatgatttttaccggaatccgcaggacggcccgctt
tcaatcgtgcttgagcaaatcaagagaaagagctga

DBGET integrated database retrieval system