KEGG   Bacillus amyloliquefaciens IT-45: KSO_016080Help
Entry
KSO_016080        CDS       T02462                                 

Definition
NADPH-ferrihemoprotein reductase
Orthology
K14338  
cytochrome P450 / NADPH-cytochrome P450 reductase [EC:1.14.14.1 1.6.2.4]
Organism
bami  Bacillus amyloliquefaciens IT-45
Pathway
Fatty acid degradation
Tryptophan metabolism
Aminobenzoate degradation
Microbial metabolism in diverse environments
Class
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:bami00071]
Metabolism; Amino acid metabolism; Tryptophan metabolism [PATH:bami00380]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:bami00627]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3238005..3241187)
Genome map
AA seq 1060 aa AA seqDB search
MKETGPIPQPKTFGPLGNLPLLDKDKPTMSLIKLANEQGPIFQLHTPAGAIIVVSGHELV
KEVCDEERFDKSIEGALEKVRAFAGDGLFTSWTHEPNWRKAHNILMPTFSQRAMKDYHSM
MTDIAVQLIQKWARLNPDEAVDVPADMTRLTLDTIGLCGFNYRFNSYYRETPHPFINSMV
RALDEAMHQMQRLDVQDKLMIRTKRQFHHDIQAMFSLVDSIIAERRSGGRDEKDLLARML
NVEDPETGEKLDDENIRFQIITFLIAGHETTSGLLSFAIYFLLKHPRVLEKAYEEADRVL
TDPVPSYKQVLELSYIRMILQESLRLWPTAPAFSLYAKEDTVIGGKYPITPKDRISVLIP
QLHREKDAWGDNAEEFYPERFEHPDQVPHHAYKPFGNGQRACIGMQFALHEATLVLGMIL
QHFTFIDHTDYELDIKQTLTIKPGDFHIRVRPRNKEAVAAALPAAEKAAEDVEKEKRETK
GASIIGLDNRPLLILYGSDTGTAEGVARELADTAGMHGVRTETAPLNDRIGKLPKEGALL
IITSSYNGKPPSNAGQFVQWLEEVKPGELEGVRYAVFGCGDHNWAATYQAVPRLIDEKLA
EKGAERFSSRGEGDVSGDFEGKLDEWKKSMWTDAMKAFGLKLNENAEKERSALGLQFVSG
LGGSPLAQTYEAVYASVAENRELQAPESGRSTRHIEITLPKEAAYHEGDHLGVLPVNSKE
QVSRVLRRFHLNGNDQVLLTASGQSAAHLPLDRPVRLHDLLSSCVELQEAASRAQIREMA
AYTVCPPHKRELEDFLEEGVYQEQILTSRVSMLDLLEKYEACELPFERFLELLRPLKPRY
YSISSSPRKHPGQASITVGVVRGPARSGLGEYRGVSSNYLADRRPEDGIVMFVRTPETRF
RLPEDPEKPIIMVGPGTGVAPFRGFLQARAALKKEGKELGEAHLYFGCRNDHDFIYRDEL
EAYEKDGIVTLHTAFSRKEGVPKTYVQHLMAKDAGALISILGRGGRLYVCGDGSKMAPDV
EATLQKAYQSVRETDERQAQEWLLDLQTKGIYAKDVWAGI
NT seq 3183 nt NT seq  +upstreamnt  +downstreamnt
atgaaggaaacaggtccgattccgcagccgaagacattcggtcctctcggcaatcttcct
ttgcttgataaagacaagcctacaatgtcgctgatcaaactggcaaacgagcaggggcct
atttttcagctgcataccccggcgggcgccattatcgtcgtgtccggacatgaactggtg
aaagaggtatgtgatgaagagcggttcgataaaagcattgaaggtgctttggagaaagtc
cgggcgtttgccggtgacgggctgtttacaagctggacgcatgagcctaactggcgaaag
gcgcataatattctgatgccgaccttcagccagcgcgcgatgaaagattatcattcgatg
atgactgatatcgcggtgcagctgattcaaaaatgggctaggctgaacccggatgaggcc
gttgatgtgcctgccgatatgacccgcctgacgctcgatacgatcgggctttgcggcttt
aactatcggtttaacagctattacagggaaacgcctcatccgtttatcaacagcatggtg
cgcgcccttgatgaagcgatgcaccaaatgcagcgccttgatgttcaggataagctcatg
atcaggacgaagcgccaatttcatcatgacattcaggcgatgttttcgttagtagacagt
attatcgcagagcgccggtcaggcggacgggatgaaaaggatctgctggccagaatgctg
aatgtggaagacccggaaacgggcgaaaaacttgatgatgaaaatatccggtttcaaatc
atcacgtttttaattgccggccacgaaacgaccagcggcctgctttcctttgccatctat
tttctgctgaaacatccccgtgttttggaaaaagcctatgaagaagccgatcgggttttg
accgatcccgttccttcttataaacaagtactggagcttagttatatccgaatgattttg
caggagtcattgcgcttatggccgaccgcgcctgcgttcagcctttatgcgaaagaggat
acggtgatcggcgggaaatatccgatcacgccgaaagacagaatttccgtcttaattccc
cagcttcaccgtgagaaagacgcgtggggagacaatgcggaggaattttatccggagcgg
tttgaacatcctgatcaagtgcctcaccatgcgtataagccgttcggaaacgggcagagg
gcgtgtatcggtatgcagttcgccctgcatgaagcaactcttgttctggggatgattctg
cagcattttacctttatcgatcacaccgattatgagctcgatattaaacagacactgacg
atcaagcccggcgactttcatatccgggtgcggccgagaaataaagaagccgttgcggct
gctctcccggcggctgaaaaagcggcggaagacgtcgaaaaagaaaaacgggaaacaaaa
ggcgcatccattatcgggcttgataaccgaccgcttctgattctgtacggctcagatacg
ggaaccgcagaaggcgtggcgcgggagcttgccgatactgccgggatgcacggcgtccgg
actgaaacggcgcctttaaatgaccggatcggaaaactgccgaaagaaggagctctcttg
atcattacgtcctcttataacggaaagcctccgagcaacgcgggacaattcgttcaatgg
cttgaagaagtcaaacccggggaactggaaggcgtccgatatgccgtcttcggctgcggt
gatcataactgggcggcgacatatcaggctgtaccgaggctgattgatgagaagcttgcc
gaaaaaggggcggaacgcttttcctcccgaggcgagggggacgtcagcggcgattttgaa
ggaaagcttgatgaatggaaaaaaagcatgtggacggacgccatgaaggcattcggtctc
aagctgaatgaaaatgccgaaaaagagcgaagtgcgctgggccttcaatttgtcagcggg
cttggcgggtctccgttggcacagacgtatgaagcggtttacgcatccgttgcggaaaac
agggaacttcaggcgccggaaagcggccggagcacaaggcatatcgaaatcactctgccg
aaagaggctgcctatcatgaaggggatcatctcggcgtgctgccggtaaacagcaaagag
caggtcagccgtgttctccgccggttccatctgaacgggaatgatcaagtgctgctgacg
gccagcggacagagcgcggctcatctcccgctcgatcggccggtcaggctgcatgatctt
ctgagcagctgtgtcgaattgcaggaagcggcatcaagggctcaaatccgggaaatggcc
gcttatacggtctgtccgccgcacaaacgggaattggaagattttcttgaggagggcgtc
tatcaggagcaaatcttaacatcgcgcgtctcgatgctcgatctccttgaaaaatatgaa
gcgtgtgaacttccgtttgagcgatttctggagcttttgcgcccgctgaagccgcggtat
tattcgatttcaagttcgcctcggaaacatcccgggcaggcttcaattaccgtcggtgtc
gttcgaggccccgcccggagcggtttgggtgagtatcgcggagtctcttcgaattattta
gcggaccgccgccctgaggatggtatcgtgatgtttgtccgcactccggaaacacgattc
cggctgccggaagatccggaaaaaccgattattatggtcggtcccggcacaggagtcgcc
ccgttccgcggatttctgcaggctcgggcagcgttaaaaaaagaaggaaaagagctgggg
gaggctcatctgtatttcggatgcagaaacgatcatgattttatttaccgtgacgagctt
gaagcttatgaaaaagacggaatcgtgacgcttcatacggctttctcccgtaaagaaggc
gtaccgaaaacgtatgtgcagcacttaatggcgaaagacgccggcgctttaatttccatc
ctcggccggggagggcgcctctacgtatgcggcgacggcagcaaaatggcgcccgatgta
gaggcaacgctgcaaaaagcgtatcagtcggtccgcgaaacagacgaacggcaagcgcaa
gaatggcttttggacctccagacaaaaggcatttacgcaaaagatgtttgggcggggatt
tga

DBGET integrated database retrieval system