KEGG   Bacillus velezensis UCMB5036: BAM5036_0940Help
Entry
BAM5036_0940      CDS       T02480                                 

Gene name
hemY
Definition
(GenBank) protoporphyrinogen IX and coproporphyrinogen III oxidase
  KO
K00231  protoporphyrinogen/coproporphyrinogen III oxidase [EC:1.3.3.4 1.3.3.15]
Organism
baml  Bacillus velezensis UCMB5036
Pathway
baml00860  Porphyrin and chlorophyll metabolism
baml01100  Metabolic pathways
baml01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:baml00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BAM5036_0940 (hemY)
Enzymes [BR:baml01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     BAM5036_0940 (hemY)
    1.3.3.15  coproporphyrinogen III oxidase (coproporphyrin-forming)
     BAM5036_0940 (hemY)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 DAO NAD_binding_9 MCRA Pyr_redox_2 HI0933_like Pyr_redox Thi4 Trp_halogenase
Motif
Other DBs
NCBI-ProteinID: CCP20991
Position
980782..982215
Genome map
AA seq 477 aa AA seqDB search
MSGDKKHLVIIGGGITGLAAAFYMEKEIKVKQLPLEVTLIEAGPRAGGKIQTQHKDGYII
ERGPDSFLERKKSAPQLVKDLGLEHLLVNNATGQSYVLVNETLHPMPKGAVMGIPTKIAP
FISTGLFSVPGKARAALDFVLPASKPKEDQSLGEFFRRRVGDEVVENLIEPLLSGIYAGD
IDKLSLMSTFPQFYQTEQKHRSLILGMKKSRPQPSGQQLTAKKQGQFLTLTTGLQTLVEE
LEKQLTLTRVMKGTKVTHIGREEKGYSVTLDNGKVLYAEGCIVTAPHKAAAKMLSDLPAV
SCLKDMHSTSVANVALGFPEGAVKMEHEGTGFVISRNSDFSITACTWTNKKWPHAAPEGK
TLLRAYVGKAGDESIVDLSDNEIIKIVMEDLKKVMKINGEPEMTCVTRWNESMPQYHVGH
KERIKEFRDALKASYPGVYATGASFEGVGIPDCIDQGKAAVYDSLAYLFETYQPPLS
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgagtggcgataaaaaacatctggtcatcatcggcggcggcataacgggattagccgcc
gccttctacatggaaaaagaaatcaaagtaaaacagctgccgcttgaggtcactctgatt
gaagcgggcccgagagcgggcggcaaaattcagacgcagcataaagacggctacatcatt
gagcgggggccggattcttttttggaaaggaaaaaaagcgcgccgcagctcgtcaaagat
ttggggcttgagcatctgcttgtcaacaatgcgaccggccagtcttacgtgctcgtcaac
gagacgctccatccgatgccgaagggcgcggtgatgggcattccgaccaaaatcgctccg
ttcatctccaccggtttattttctgttcccggaaaggcgcgggcggcgcttgactttgtc
ctgcctgcgagcaaaccgaaggaagatcagtctctgggtgaatttttccgcagacgcgtc
ggtgacgaagtcgttgagaatttaatagaaccgctattatcagggatttatgccggagat
attgataagctgagcctcatgtccacgtttccgcaattctatcagactgagcagaagcac
agaagcctgattctcggcatgaaaaaatcgcgtccgcagccttcgggacagcagctgaca
gccaaaaagcagggccagtttttaacgctgacaacagggcttcaaacgttggtggaggag
ctggaaaagcagcttacgctgacaagggtgatgaaaggaacgaaagtcacccatatcggc
cgcgaggagaaaggatattctgtgacgcttgataacggcaaagtgctctatgcggaagga
tgcatagtaacagccccgcataaagccgcggcgaaaatgctttctgatctgccggcggtt
tcatgtctcaaagacatgcattctacgtccgttgccaatgttgccttaggttttcctgag
ggtgccgtcaagatggagcatgaaggtacgggattcgttatctcaagaaacagcgacttc
tccatcacggcctgcacatggacgaataaaaaatggccgcacgcggcgccggagggcaaa
acgcttctcagggcgtacgtcggaaaggccggggatgaatccatcgtagatctttcagat
aacgagatcattaaaatcgtaatggaagatttgaaaaaagtaatgaaaataaatggcgaa
ccggaaatgacctgtgtgacccgctggaacgaaagcatgccgcaataccatgtcggccat
aaggagcgcatcaaagagttcagagatgcgctgaaagcttcctatccgggcgtatacgcg
acgggcgcgtctttcgaaggggtgggcatccccgactgtatcgaccagggaaaagccgcc
gtatacgattcactggcttatttatttgaaacgtaccagcctccgttatcgtaa

DBGET integrated database retrieval system