KEGG   Bacillus amyloliquefaciens subsp. plantarum UCMB5036: BAM5036_1138Help
Entry
BAM5036_1138      CDS       T02480                                 

Gene name
yjjA
Definition
putative enzyme
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
baml  Bacillus amyloliquefaciens subsp. plantarum UCMB5036
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:baml00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1168843..1169661
Genome map
AA seq 272 aa AA seqDB search
MGKGLNGKRIAIGGSRKTEEITRLIEKQGGTAVVRSLQGTVYLAEDQIEPDVRTFAGQKA
DWVIFTTGIGTETLLSVSEKIGLKEEFLAAVHEAKIGCRGYKTYAALKKLGITPHASDED
GTTRGLIRSLERFDFKDKKVMIQLHGEKAPVLTEFLEKNGAEVFPVLPYQHIPPERETVD
KLLGELLNGEVDAVCFTTAIQVRSLFDYAKEKGFTKELQQAFEKQVLAAAVGKVTAEAIR
DEGVKRVLAPDIERMGAMIIELSRYYESLTLS
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgggaaaaggattgaacgggaaacggattgccatcggcggttcgcggaaaacagaagag
atcacaagattaatagaaaagcagggcggaacggcggtcgtccgttccctccaaggaacc
gtatacctggcggaggatcaaattgaacccgacgtaagaacatttgccgggcaaaaagcc
gactgggtaatattcaccacaggcatcggtacggaaacgttattgtcggtatcggaaaaa
atcggtctgaaagaagaatttttagcggccgttcatgaagcgaaaatcggctgcagaggc
tataaaacatatgcggccttaaaaaagctcggcatcacgccgcatgcctcagatgaagac
ggtacaacaagagggctgatccgctccttggaacgatttgactttaaagataaaaaagtc
atgatacagcttcatggcgaaaaagcgccggtcttaacggagttccttgagaaaaacgga
gcggaggtattccctgttctgccgtatcagcatattccgcctgaaagggagacggtcgat
aaactgctgggagagctgttaaacggagaggtcgatgccgtatgttttacgacagccatt
caagtgcgttctctctttgattatgcaaaagaaaaagggttcacaaaagaattgcagcag
gcattcgaaaaacaagtgcttgccgccgcagtcggcaaagtgacggctgaagcgatccgg
gatgaaggggtaaagagggtccttgctccggacattgagcggatgggagcgatgattatt
gaattatcccgttactatgaatctctgaccttgtcataa

DBGET integrated database retrieval system