KEGG   Bacillus amyloliquefaciens subsp. plantarum UCMB5036: BAM5036_1228Help
Entry
BAM5036_1228      CDS       T02480                                 

Gene name
proB
Definition
Glutamate 5-kinase 1 (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
baml  Bacillus amyloliquefaciens subsp. plantarum UCMB5036
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:baml01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:baml00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1247268..1248380
Genome map
AA seq 370 aa AA seqDB search
MKKQRIVVKIGSSSLTNSNGSIDEAKIKEHTEAISLLKENGHEVILITSGAVAAGFSALG
YPSRPVTIKGKQAAAAVGQTLLMQQYMDHLKRYGLTPAQILLTRNDFSKRERYRNAYATV
MELLERGVVPIINENDSTSVEELTFGDNDMLSALVSGLIHADQLMILTDINGLYDANPNE
NPDAKRFDYLNDITPELLGYAGSAGSKVGTGGMKSKLLAAQTALSLGVKVFIGTGSGREK
LMVILDGKGDGTYIGDKDLSSVNNTRQWIMFHSPISGEIIIDGGAEQAMIHNGSSLLPAG
VADVCGSFPKGAVVEVKGPGGMIGKGQTQYSSDEILEAKGKRSDQLSGTKQVEVIHRDDW
VNLFDEGEHK
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaacaaagaattgttgtgaaaatcgggagcagctcgctcaccaacagtaacgga
agtattgatgaagcaaaaatcaaggaacatacggaagccatttctttattaaaagaaaac
gggcatgaagtgatcctcattacctcaggcgcggtggcagcgggtttttccgctctcggc
tatccgtcgcgacctgttacgataaaaggaaagcaggcagctgccgcagtcggccagacg
cttttaatgcagcaatatatggaccatttaaaaagatacggtctgacgccggcacaaatt
ttattaacaagaaatgatttctcaaaaagagagcggtacagaaacgcctatgccactgta
atggaactgttggagcgtggagtcgtgccgattattaatgagaatgattccacatcagtc
gaagagctgacgttcggtgataacgacatgctgtcggcgcttgtaagcggtttgattcat
gcagaccaattaatgattctcacagacattaacgggctgtacgatgccaatccgaatgaa
aacccggacgcaaagcggttcgactatctgaatgacatcacaccagaattgctcggatat
gccggatcagcaggctcaaaggtcggcaccggaggtatgaagtcaaaacttctcgccgcc
cagaccgcattgtcgctcggggtgaaggtatttatcggaaccggctccggacgggaaaaa
ctgatggtgattttagacggaaaaggcgacggcacttatatcggcgataaagacctgtcc
tcagtgaataatacacggcaatggatcatgtttcattctccgatatcaggggaaatcatc
attgatgggggagcggagcaggcgatgatccataacgggtcaagtctcctcccggccggt
gtcgccgatgtctgcggcagttttccgaaaggggccgtagtggaagtcaaagggcccggc
ggcatgatcggcaaagggcagacgcagtactcatccgatgaaattttagaagccaaaggg
aagcggagcgaccagctttcaggaacgaagcaggtggaagtgattcacagagatgattgg
gtgaatttatttgacgagggggaacacaaatga

DBGET integrated database retrieval system